DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actbeta and INHBB

DIOPT Version :9

Sequence 1:NP_651942.2 Gene:Actbeta / 43826 FlyBaseID:FBgn0024913 Length:946 Species:Drosophila melanogaster
Sequence 2:NP_002184.2 Gene:INHBB / 3625 HGNCID:6067 Length:407 Species:Homo sapiens


Alignment Length:403 Identity:116/403 - (28%)
Similarity:175/403 - (43%) Gaps:105/403 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   559 DINHSID--------NKTHTGKNGEMSHNDYEYFNDYSVQTHDKNRYHEGRSSIGYQPAIHNIEY 615
            :|.|::.        .|.|.||..|                       :||           :|.
Human    93 NITHAVPKAAMVTALRKLHAGKVRE-----------------------DGR-----------VEI 123

  Fly   616 ENQKGHHESFADDHENIDHEDFFGNTQEIITFAE-EGTQYRQYRILEFSAQNRRVPSQKLSIRSA 679
            .:..||....||..|.:         .|||:||| :|....:.|:..|.:..   .:|.|.:..|
Human   124 PHLDGHASPGADGQERV---------SEIISFAETDGLASSRVRLYFFISNE---GNQNLFVVQA 176

  Fly   680 QIHIRIDKPHSLWIEKAKSLPEKHLLNTKRKWGANKPHHRIKIWVFQ---LSTSINITEKGIDKA 741
                      |||: ..|.||......::||       .|:|:: ||   .....|:.||     
Human   177 ----------SLWL-YLKLLPYVLEKGSRRK-------VRVKVY-FQEQGHGDRWNMVEK----- 217

  Fly   742 IIFRASFQVDPKNLGWQKFDLTDTIREWYGHTSHEKLRLLIDCTGCGGRYSLHLFQTSKLRGNSS 806
                   :||.|..||..|.||:.|:..: .....:|.|.:.|..|.....:.:|...   |..|
Human   218 -------RVDLKRSGWHTFPLTEAIQALF-ERGERRLNLDVQCDSCQELAVVPVFVDP---GEES 271

  Fly   807 DYLSTNPNRPFLVLHTESSRTR-RVRRRAVDCGGALNGQCCKESFYVSFKALGWDDWIIAPRGYF 870
                   :|||:|:......:| |:|:|.::|.|..| .||::.|::.|:.:||:||||||.||:
Human   272 -------HRPFVVVQARLGDSRHRIRKRGLECDGRTN-LCCRQQFFIDFRLIGWNDWIIAPTGYY 328

  Fly   871 ANYCRGDCTGSFR-TPDTFQTFHAHFIEEYRKMGLMNG-MRPCCAPIKFSSMSLIYYGDD-GIIK 932
            .|||.|.|..... .|.:..:||...:.:||..||..| :..||.|.|.|:||::|:.|: .|:|
Human   329 GNYCEGSCPAYLAGVPGSASSFHTAVVNQYRMRGLNPGTVNSCCIPTKLSTMSMLYFDDEYNIVK 393

  Fly   933 RDLPKMVVDECGC 945
            ||:|.|:|:||||
Human   394 RDVPNMIVEECGC 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ActbetaNP_651942.2 TGFb_propeptide 370..>509 CDD:279078
TGF_beta 843..945 CDD:278448 45/104 (43%)
INHBBNP_002184.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 26..62
TGFb_propeptide 57..278 CDD:279078 61/272 (22%)
TGFB 303..406 CDD:214556 45/102 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 116 1.000 Domainoid score I5953
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 180 1.000 Inparanoid score I4007
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1385831at2759
OrthoFinder 1 1.000 - - FOG0000887
OrthoInspector 1 1.000 - - otm40920
orthoMCL 1 0.900 - - OOG6_109477
Panther 1 1.100 - - O PTHR11848
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4608
SonicParanoid 1 1.000 - - X477
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1110.900

Return to query results.
Submit another query.