DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actbeta and INHBA

DIOPT Version :9

Sequence 1:NP_651942.2 Gene:Actbeta / 43826 FlyBaseID:FBgn0024913 Length:946 Species:Drosophila melanogaster
Sequence 2:XP_016867663.1 Gene:INHBA / 3624 HGNCID:6066 Length:548 Species:Homo sapiens


Alignment Length:467 Identity:130/467 - (27%)
Similarity:188/467 - (40%) Gaps:133/467 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   527 PKELKSGAVRKVNGINGTQMNENALKKS---TYPID---INHSIDNKTHTGKNGEMSHNDYEYFN 585
            ||::.:.....|..:....:|...|||.   |.|:.   :.::| .|.|.||.||          
Human   166 PKDVPNSQPEMVEAVKKHILNMLHLKKRPDVTQPVPKAALLNAI-RKLHVGKVGE---------- 219

  Fly   586 DYSVQTHDKNRYHEGRSSIGYQPAIHNIEYENQKGHHESFADDHENIDHEDFFGNTQEIITFAEE 650
                     |.|.|....||                        ...:..:....|.|||||||.
Human   220 ---------NGYVEIEDDIG------------------------RRAEMNELMEQTSEIITFAES 251

  Fly   651 GTQYRQYRILEFSAQNRRVPSQKLSIRSAQIHIRIDKPHS--LWIEKAK-----SLPEKHLLNTK 708
            ||..:                        .:|..|.|..|  ..:|:|:     .:|:       
Human   252 GTARK------------------------TLHFEISKEGSDLSVVERAEVWLFLKVPK------- 285

  Fly   709 RKWGANKPHHRIKIWVFQ--------LSTSINITEKGI--DKAIIFRASFQVDPKNLGWQKFDLT 763
                ||:...::.|.:||        |.|.....|.|:  :::.:..:...||.:...|..|.::
Human   286 ----ANRTRTKVTIRLFQQQKHPQGSLDTGEEAEEVGLKGERSELLLSEKVVDARKSTWHVFPVS 346

  Fly   764 DTIREW--YGHTSHEKLRLLIDCTGC--GGRYSLHLFQTSKLR--------------GNSSDYLS 810
            .:|:..  .|.:|   |.:.|.|..|  .|. ||.|....|.:              |..:|...
Human   347 SSIQRLLDQGKSS---LDVRIACEQCQESGA-SLVLLGKKKKKEEEGEGKKKGGGEGGAGADEEK 407

  Fly   811 TNPNRPFLVLHTESS--RTRRVRRRAVDCGGALNGQCCKESFYVSFKALGWDDWIIAPRGYFANY 873
            ...:||||:|....|  ...|.|||.::|.|.:| .|||:.|:||||.:||:||||||.||.|||
Human   408 EQSHRPFLMLQARQSEDHPHRRRRRGLECDGKVN-ICCKKQFFVSFKDIGWNDWIIAPSGYHANY 471

  Fly   874 CRGDCTGSFR-TPDTFQTFHAHFIEEYRKMG--LMNGMRPCCAPIKFSSMSLIYYGDDG--IIKR 933
            |.|:|..... |..:..:||:..|..||..|  ....::.||.|.|...||::|| |||  |||:
Human   472 CEGECPSHIAGTSGSSLSFHSTVINHYRMRGHSPFANLKSCCVPTKLRPMSMLYY-DDGQNIIKK 535

  Fly   934 DLPKMVVDECGC 945
            |:..|:|:||||
Human   536 DIQNMIVEECGC 547

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ActbetaNP_651942.2 TGFb_propeptide 370..>509 CDD:279078
TGF_beta 843..945 CDD:278448 50/106 (47%)
INHBAXP_016867663.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 116 1.000 Domainoid score I5953
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H1653
Inparanoid 1 1.050 180 1.000 Inparanoid score I4007
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1385831at2759
OrthoFinder 1 1.000 - - FOG0000887
OrthoInspector 1 1.000 - - otm40920
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11848
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4608
SonicParanoid 1 1.000 - - X477
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1111.000

Return to query results.
Submit another query.