DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actbeta and INHA

DIOPT Version :9

Sequence 1:NP_651942.2 Gene:Actbeta / 43826 FlyBaseID:FBgn0024913 Length:946 Species:Drosophila melanogaster
Sequence 2:NP_002182.1 Gene:INHA / 3623 HGNCID:6065 Length:366 Species:Homo sapiens


Alignment Length:414 Identity:85/414 - (20%)
Similarity:123/414 - (29%) Gaps:171/414 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   605 GYQPAIHNIEYENQKG---HHESFADDHENIDHEDFF--------------GNTQEIITFAEEGT 652
            |..|.:..:...:..|   |..|..::.|::.....|              |..||    ||||.
Human    50 GGDPGVRRLPRRHALGGFTHRGSEPEEEEDVSQAILFPATDASCEDKSAARGLAQE----AEEGL 110

  Fly   653 QYRQYRILEFSAQNRRVPSQ---KLSIRSAQI--HIRIDKPHSLWIEKAKSLPEKHLLN------ 706
            ....:|           |||   ...:.|||:  |..:|:..:     |.|...:.||.      
Human   111 FRYMFR-----------PSQHTRSRQVTSAQLWFHTGLDRQGT-----AASNSSEPLLGLLALSP 159

  Fly   707 -----TKRKWGANKPHHRIKIW-VFQLSTSINITEKGIDKAIIFRASFQVDPKNLGWQKFDLTDT 765
                 .....|...||     | |..|:||.                                  
Human   160 GGPVAVPMSLGHAPPH-----WAVLHLATSA---------------------------------- 185

  Fly   766 IREWYGHTSHEKLRLLIDCTGCGGRYSLHLFQTSKLRGNSSDYLSTNPNRPFLVLHTESSRTR-- 828
                ....:|..|.||:.|..|          |...|..::         ||||.||   |||  
Human   186 ----LSLLTHPVLVLLLRCPLC----------TCSARPEAT---------PFLVAHT---RTRPP 224

  Fly   829 ----RVRRRAVDCG-----------------GALNGQCCKESFYVSFKALGWDDWIIAPRGYFAN 872
                |.||......                 .|.:..|.:.:..:||:.|||:.||:.|..:..:
Human   225 SGGERARRSTPLMSWPWSPSALRLLQRPPEEPAAHANCHRVALNISFQELGWERWIVYPPSFIFH 289

  Fly   873 YCRGDC------------TGSFRTPDTFQTFHAHFIEEYRKMGLMNGMRPCCAPIKFSSMSL-IY 924
            ||.|.|            .|:..||          .:.|   .|:.|.:||||.:..:...| :.
Human   290 YCHGGCGLHIPPNLSLPVPGAPPTP----------AQPY---SLLPGAQPCCAALPGTMRPLHVR 341

  Fly   925 YGDDG---IIKRDLPKMVVDECGC 945
            ...||   .....:|.::...|.|
Human   342 TTSDGGYSFKYETVPNLLTQHCAC 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ActbetaNP_651942.2 TGFb_propeptide 370..>509 CDD:279078
TGF_beta 843..945 CDD:278448 28/117 (24%)
INHANP_002182.1 TGFB 262..366 CDD:214556 29/117 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11848
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.