DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actbeta and spaw

DIOPT Version :9

Sequence 1:NP_651942.2 Gene:Actbeta / 43826 FlyBaseID:FBgn0024913 Length:946 Species:Drosophila melanogaster
Sequence 2:NP_851298.1 Gene:spaw / 338101 ZFINID:ZDB-GENE-030219-1 Length:404 Species:Danio rerio


Alignment Length:244 Identity:52/244 - (21%)
Similarity:103/244 - (42%) Gaps:47/244 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   747 SFQVDPKNLGWQKFDLTDTIREW--YGHTSHEKLRLLIDCTGCGG-------------------- 789
            |..|...:..|:.|::|:.:::|  .|..:.:::.......|.|.                    
Zfish   162 SVDVSQSSSSWRVFNITELLQQWLIQGMDTPDRVTAPDYDQGSGSGSGDDFIESLTSSWPRKIQH 226

  Fly   790 ----RYSLHLFQTSKLRGNSSDYLSTNPNRPFLVLHTESSRTR-------RVRRRAVDCGGALNG 843
                |..:.:|....:..::|..::|.....::.|:..:..|:       ||.|..:.....:.|
Zfish   227 PTAERVMIVVFYKETVTHSASSLMNTVAQSKYVTLNRPADGTQGRRHKRNRVERMRMTDDRNVTG 291

  Fly   844 Q-----------CCKESFYVSFKALGWDDWIIAPRGYFANYCRGDCTGSFRTPDTFQTFHAHFIE 897
            :           |.:...:|.|..:|||:||:.|:.|.|..|.|:|....  .:|:...:..:::
Zfish   292 KPTPSEEQQASLCRRVDMWVDFDQIGWDEWIVHPKRYNAYRCEGECPSPL--DETYNPTNHAYMQ 354

  Fly   898 EYRKMGLMNGMR-PCCAPIKFSSMSLIYYGDDGIIKRDLPKMVVDECGC 945
            ...|:.....:. |.|.|::.||:|::||..||::.|....|:|:||||
Zfish   355 SLLKLYQPERVSCPSCVPLRLSSLSMLYYEGDGVVMRHHEDMIVEECGC 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ActbetaNP_651942.2 TGFb_propeptide 370..>509 CDD:279078
TGF_beta 843..945 CDD:278448 32/113 (28%)
spawNP_851298.1 TGFb_propeptide 50..188 CDD:366248 6/25 (24%)
TGF_beta_NODAL 302..404 CDD:381637 33/104 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.