Sequence 1: | NP_651942.2 | Gene: | Actbeta / 43826 | FlyBaseID: | FBgn0024913 | Length: | 946 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001018320.1 | Gene: | bmp15 / 334183 | ZFINID: | ZDB-GENE-030131-6115 | Length: | 384 | Species: | Danio rerio |
Alignment Length: | 246 | Identity: | 60/246 - (24%) |
---|---|---|---|
Similarity: | 83/246 - (33%) | Gaps: | 98/246 - (39%) |
- Green bases have known domain annotations that are detailed below.
Fly 757 WQKFDLTDTIREWYGHTSHEKLRLLIDCTGCGGRYSLHLFQTSKLRGNSSDYLSTNPNR------ 815
Fly 816 ------------PFLVLHTESS----------------RTRRVRRRAVDCGGAL----------- 841
Fly 842 ----NGQCCKESFYVSFKALGWDDWIIAPRGYFANYCRGDCTG----SFRTPDTFQTFHA---HF 895
Fly 896 IEEYRKMGLMNGMRPCCAPIKFSSMSLIYYGDDGIIK-RDLPKMVVDECGC 945 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Actbeta | NP_651942.2 | TGFb_propeptide | 370..>509 | CDD:279078 | |
TGF_beta | 843..945 | CDD:278448 | 38/109 (35%) | ||
bmp15 | NP_001018320.1 | TGF_beta | 281..383 | CDD:278448 | 38/109 (35%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |