DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actbeta and bmp15

DIOPT Version :9

Sequence 1:NP_651942.2 Gene:Actbeta / 43826 FlyBaseID:FBgn0024913 Length:946 Species:Drosophila melanogaster
Sequence 2:NP_001018320.1 Gene:bmp15 / 334183 ZFINID:ZDB-GENE-030131-6115 Length:384 Species:Danio rerio


Alignment Length:246 Identity:60/246 - (24%)
Similarity:83/246 - (33%) Gaps:98/246 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   757 WQKFDLTDTIREWYGHTSHEKLRLLIDCTGCGGRYSLHLFQTSKLRGNSSDYLSTNPNR------ 815
            |.:.|:||       |.|..|          .|..|..           :.|..|.|..      
Zfish   179 WTETDVTD-------HVSESK----------DGHVSFF-----------ARYWCTKPEHKRSVAH 215

  Fly   816 ------------PFLVLHTESS----------------RTRRVRRRAVDCGGAL----------- 841
                        |.|:|..|.:                ||||.::     .|::           
Zfish   216 RKRFPPQHHLRAPLLLLFLEENKHPVEWGKSFPPLSRPRTRRSKK-----SGSIVSDIPNFKQGL 275

  Fly   842 ----NGQCCKESFYVSFKALGWDDWIIAPRGYFANYCRGDCTG----SFRTPDTFQTFHA---HF 895
                ...|...|..|.||.||||.|:|||..|...||.|||..    .:.:|:     ||   .|
Zfish   276 NRVTKNNCKLYSSSVDFKDLGWDHWVIAPHKYNPGYCMGDCPRILHYGYNSPN-----HAIMQTF 335

  Fly   896 IEEYRKMGLMNGMRPCCAPIKFSSMSLIYYGDDGIIK-RDLPKMVVDECGC 945
            |.|   :|:.:...|.|.|.|:..||::..|.:|.|. ::...|:.|.|.|
Zfish   336 ISE---LGVADIPLPSCVPYKYKRMSMLVMGSNGQIDYKEYEDMIADSCTC 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ActbetaNP_651942.2 TGFb_propeptide 370..>509 CDD:279078
TGF_beta 843..945 CDD:278448 38/109 (35%)
bmp15NP_001018320.1 TGF_beta 281..383 CDD:278448 38/109 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.