DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actbeta and bmp7a

DIOPT Version :9

Sequence 1:NP_651942.2 Gene:Actbeta / 43826 FlyBaseID:FBgn0024913 Length:946 Species:Drosophila melanogaster
Sequence 2:NP_571396.1 Gene:bmp7a / 30584 ZFINID:ZDB-GENE-000208-25 Length:432 Species:Danio rerio


Alignment Length:374 Identity:95/374 - (25%)
Similarity:139/374 - (37%) Gaps:130/374 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   637 FFGNTQEIITFA-----EEGTQ-YRQYRILEFSAQNRRVPSQKLSIRSAQIHIRID------KPH 689
            |..:...:::||     ||..| |.|:| .||.....|:|..: ::.:|:..|..|      :..
Zfish   123 FLSDADMVMSFANTVDPEEDLQLYHQHR-REFRFDLSRIPPGE-TVTAAEFRIYKDFVRERYENE 185

  Fly   690 SLWIEKAKSLPEKH-----LLNTKRKWGANKPHHRIKIWVFQLSTSINITEKGIDKAIIFRASFQ 749
            :..:...:.|.::|     ||:::..|.|.:                                  
Zfish   186 TFHVSVFQVLQQQHRRELYLLDSRVVWAAEE---------------------------------- 216

  Fly   750 VDPKNLGWQKFDLTDTIREWYGHTSHE-KLRLLIDCTGCGGRYSLHLFQTSKLRGNSSDYLSTNP 813
                  ||..||||.|...|..:.... .|:||:: |..|.|.:.   :.:.|.|:|    ....
Zfish   217 ------GWLVFDLTVTSNHWVINPGQNLGLQLLVE-TSHGARMNP---RRAGLVGSS----GAQN 267

  Fly   814 NRPFLVLHTESS--RTRRVRRRAVDCGGALNGQ-------------------------------- 844
            .:||:|...::|  ..|.||..:   ||...|.                                
Zfish   268 KQPFMVAFLKASGIHLRSVRSAS---GGKQKGHHRTKNAKPGAAHSQVALKTAEATEGASIDPKQ 329

  Fly   845 -CCKESFYVSFKALGWDDWIIAPRGYFANYCRGDCT---GSFRTPDTFQTFHA------HFI--E 897
             |.|...||||:.|||.||||||.||.|.||.|:|.   .|:..    .|.||      |||  |
Zfish   330 GCKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECVFPLNSYMN----ATNHAIVQTLVHFINPE 390

  Fly   898 EYRKMGLMNGMRPCCAPIKFSSMSLIYYGD-DGIIKRDLPKMVVDECGC 945
            ...|        |||||.:...:|::|:.| ..:|.:....|||..|||
Zfish   391 TVPK--------PCCAPTQLHGISVLYFDDSSNVILKKYRNMVVRACGC 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ActbetaNP_651942.2 TGFb_propeptide 370..>509 CDD:279078
TGF_beta 843..945 CDD:278448 45/146 (31%)
bmp7aNP_571396.1 TGFb_propeptide 34..275 CDD:279078 42/201 (21%)
TGF_beta 329..431 CDD:278448 44/113 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.