DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actbeta and lft2

DIOPT Version :9

Sequence 1:NP_651942.2 Gene:Actbeta / 43826 FlyBaseID:FBgn0024913 Length:946 Species:Drosophila melanogaster
Sequence 2:NP_571036.1 Gene:lft2 / 30146 ZFINID:ZDB-GENE-990630-11 Length:362 Species:Danio rerio


Alignment Length:425 Identity:103/425 - (24%)
Similarity:158/425 - (37%) Gaps:132/425 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   559 DINHSIDNKTHTGKNGEMSHNDYEYFNDYSVQTHDKNRY-------HE-GRSSIGYQPAIHNIEY 615
            ||..::..|....:...:...|.|   :..|..|.|::|       |: .|.|:   |::..|  
Zfish    24 DIKQALLQKLGLTEPPRIQKRDLE---NLVVPAHIKSKYLSMLKLHHQRRRRSL---PSLAGI-- 80

  Fly   616 ENQKGHHESFADDHENIDHEDFFGNTQEIITFAEEGTQYRQYRILEFSAQNRRVPSQKLSI--RS 678
              .:|.|.: ||....|.:.|   .|::.:.|..|.      |:.|    |..|...:|.:  .:
Zfish    81 --LRGIHGN-ADITGEIKYSD---TTRQRLVFDMEA------RLQE----NTEVTMAELKLFQTA 129

  Fly   679 AQIHIRIDKPHSLWIEKAKSLPEKHLLNTKRKWGANKP--HHRIKI-WVFQLSTSINITEKGIDK 740
            ||               :.|.||:.         .::|  |.|:.| ||..|....|.|.....:
Zfish   130 AQ---------------SPSKPERR---------HHRPINHARVSIYWVEVLENGSNRTSLLDSR 170

  Fly   741 AIIFRASFQVDPKNLGWQKFDLTDTIREWYGHTSHEKLRLLIDCTGCG---GRYSLHL-----FQ 797
            .:....|        ||:.||:|..|..|  ..|.:|..|.::....|   |.|:..:     |.
Zfish   171 LVPIHES--------GWRSFDVTQAIHYW--SKSQKKAPLHLEVWTEGERPGSYAAEMAKRVRFA 225

  Fly   798 TSKLRGNSSDYLSTNPNRPFLVLHTESSRTRRVRRRAVD---------CGGALN-GQCCKESFYV 852
            |...:.|:   |..:...|.|||:|            :|         |..:.| .:||:|..::
Zfish   226 TQDPKENT---LEKDMGAPELVLYT------------LDLDEYGSQGNCNSSPNSSKCCREEHFI 275

  Fly   853 SFKALGWDD-WIIAPRGYFANYCRGDCTGSFRTPDTFQTFHAHFIEEYRKMGLMN-GMRPCC--- 912
            :|:.|.|.. |||.|.||.|..|.|.|    :.|               |.|... |.|.|.   
Zfish   276 NFRELTWTQYWIIEPAGYQAFRCAGGC----KQP---------------KRGFYGYGQRTCAVME 321

  Fly   913 -APIKFSSMSLIYYGDDGIIK-RDLPKMVVDECGC 945
             ||:..  |.|:..||...|: .:.|.|:|::|||
Zfish   322 SAPLPM--MYLVKKGDYTEIEVAEFPNMIVEKCGC 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ActbetaNP_651942.2 TGFb_propeptide 370..>509 CDD:279078
TGF_beta 843..945 CDD:278448 33/108 (31%)
lft2NP_571036.1 TGFb_propeptide 15..204 CDD:366248 53/237 (22%)
TGF_beta_LEFTY1_2 267..354 CDD:381636 33/107 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11848
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.