DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actbeta and gdf3

DIOPT Version :9

Sequence 1:NP_651942.2 Gene:Actbeta / 43826 FlyBaseID:FBgn0024913 Length:946 Species:Drosophila melanogaster
Sequence 2:NP_571023.1 Gene:gdf3 / 30125 ZFINID:ZDB-GENE-980526-389 Length:355 Species:Danio rerio


Alignment Length:342 Identity:83/342 - (24%)
Similarity:127/342 - (37%) Gaps:111/342 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   701 EKHLLNTKRKWGANKPHHRI----KIW-VFQLST--SIN----ITEKG----------------- 737
            ||..|::...|...||.|..    ::| :|:.::  ::|    ::|.|                 
Zfish    27 EKLFLSSMGLWSRPKPSHHAAVPSQMWKIFKQASKQTVNDPCVVSEYGVRGNIVRFMQDQGSLIS 91

  Fly   738 ---------IDKAIIFRAS----------------FQVDPKNLGWQKF--DLTDTIREWYGHTSH 775
                     :.|.:.|..|                |:.|...||...|  ||...::......:|
Zfish    92 APAVHSFNCVRKHLFFNMSVLEEVEQLSLAQLEMKFKQDLLLLGPHVFSVDLYRVLKTTLKGVTH 156

  Fly   776 EKLR---------------LLIDCTGCG-------GRYSLHL-FQTSKLRGNSSDY--------- 808
            |..|               :|::.|...       ..:.:.| .|...|.....|:         
Zfish   157 ESSRKLLQSQTLSPGAHASVLVNLTNLAQSWRKPEKNFGMQLELQVMHLNNMLHDHAYVQIPDIH 221

  Fly   809 -----LSTNPNRPFLVLHTESSRTRRVRRRAVDCGGALNGQCCKESFYVSFKALGWDDWIIAPRG 868
                 :|.||.:         .|:||.|..:.......:..|.....|:.||.:||.||||||:|
Zfish   222 ATLVVVSLNPLQ---------CRSRRKRSASYYLPVTPSNVCKPRRLYIDFKDVGWQDWIIAPQG 277

  Fly   869 YFANYCRGDCTGSFRTPDTFQ-TFHA---HFIEEYRKMGLMNGMRPCCAPIKFSSMSLIYY-GDD 928
            |.||||.|:|  .|...::.. |.||   ..:..:...|.   .:|||.|||.|.:|::|| .:|
Zfish   278 YLANYCHGEC--PFPLSESLNGTNHAILQTLVHSFDPKGT---PQPCCVPIKLSPISMLYYDNND 337

  Fly   929 GIIKRDLPKMVVDECGC 945
            .::.|....||||||||
Zfish   338 NVVLRHYEDMVVDECGC 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ActbetaNP_651942.2 TGFb_propeptide 370..>509 CDD:279078
TGF_beta 843..945 CDD:278448 43/106 (41%)
gdf3NP_571023.1 TGFb_propeptide 27..200 CDD:279078 28/172 (16%)
TGFB 254..355 CDD:214556 45/106 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.