DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actbeta and Gdf15

DIOPT Version :9

Sequence 1:NP_651942.2 Gene:Actbeta / 43826 FlyBaseID:FBgn0024913 Length:946 Species:Drosophila melanogaster
Sequence 2:NP_062089.1 Gene:Gdf15 / 29455 RGDID:2674 Length:303 Species:Rattus norvegicus


Alignment Length:304 Identity:66/304 - (21%)
Similarity:123/304 - (40%) Gaps:68/304 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   669 VPSQKLSIRSAQIH------------IRIDKPHSLWIEKAKSLPEK--HLLNTKRKWGANKPHHR 719
            :|.|:.|:..:|::            .|:....|.....::..|:.  .:|:.:.:.|:   |.|
  Rat    40 LPEQRRSLSESQLNPDELRGRFQDLLSRLHANQSREDSNSEPTPDPAVRILSPEVRLGS---HGR 101

  Fly   720 IKIWVFQLSTSINITEKGIDKAI-IFRASFQVDPKNLGWQKFDLTDTIREWYG----HTSHEKLR 779
            :.:.|.:.|.:     :|:.:|. :.||...:.|.:..|   |:|..::....    |....:||
  Rat   102 LLLRVNRASLT-----QGLPEAYRVHRALLLLTPSSRPW---DITRPLQRAISLQGPHARALRLR 158

  Fly   780 L-----LIDCTGCGGRYSLHLFQTSKLRGNSSDYLSTNPNRPFLVLHTESSRTRRVRRRAVDCGG 839
            |     |......|.|..||| :::..||..|.:|....:.|.                     |
  Rat   159 LAPPPDLAVLPSGGARLELHL-RSAAGRGRRSAHLHPRDSCPL---------------------G 201

  Fly   840 ALNGQCCK-ESFYVSFKALGWDDWIIAPRGYFANYCRGDCTGSFRTPDTFQTFHAHFIEEYRKMG 903
            .  |:||. |:...:.:.|||.||:::||....:.|.|:|      |..:::.:.|.:.:.|..|
  Rat   202 P--GRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGEC------PHLYRSANTHALIKARLHG 258

  Fly   904 LMNGM--RPCCAPIKFSSMSLIYYGDDGIIKRDLPKMVVDECGC 945
            |....  .|||.|..::.:.|::..|.|:..:....:|...|.|
  Rat   259 LQPDRVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVAQGCHC 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ActbetaNP_651942.2 TGFb_propeptide 370..>509 CDD:279078
TGF_beta 843..945 CDD:278448 28/104 (27%)
Gdf15NP_062089.1 TGF_beta 204..302 CDD:278448 27/103 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.