DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actbeta and Nodal

DIOPT Version :9

Sequence 1:NP_651942.2 Gene:Actbeta / 43826 FlyBaseID:FBgn0024913 Length:946 Species:Drosophila melanogaster
Sequence 2:NP_001099864.1 Gene:Nodal / 294503 RGDID:1305994 Length:354 Species:Rattus norvegicus


Alignment Length:294 Identity:62/294 - (21%)
Similarity:111/294 - (37%) Gaps:88/294 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   668 RVPSQKLSIRSAQIH-------IRIDKPHSLWIEKAKSLPEKHLLNTKRKWGANKPHHRIKIWVF 725
            ||..:::::..:|:.       :.:.||.|.|::..::| ||.:.:...           |.|..
  Rat   132 RVWMERITVTPSQVTFASDSTVLEVTKPLSKWLKDPRAL-EKQVSSQAG-----------KCWHQ 184

  Fly   726 QLSTSINITEKGIDKAIIFRASFQVDPKNLGWQKFDLTDTIREWYGHTSHEKLRLLIDCTGCGGR 790
            ..:..:.:|...:   ::..::...:.:.||.... |.:....|..    ::.:|.::.:|.|.|
  Rat   185 SHTQPVPVTSTSV---LMLYSNRPQEQRQLGGATL-LWEAESSWRA----QEGQLSVERSGWGRR 241

  Fly   791 YSLHLFQTSKLRGNSSDYLSTNPNRPFLVLHTESSRTRRVRRRAVDCGGALNGQCCKESFYVSFK 855
            ...|..                |:|        |...|||:                  |.|.|.
  Rat   242 QRRHHL----------------PDR--------SQLCRRVK------------------FQVDFN 264

  Fly   856 ALGWDDWIIAPRGYFANYCRGDC---TGSFRTPDTFQTFHAHFIEEYRKMGLMNGMRP------C 911
            .:||..|||.|:.|.|..|.|:|   .|....|    |.||:.      ..|:...:|      |
  Rat   265 LIGWGSWIIYPKQYNAYRCEGECPNPVGEEFHP----TNHAYI------QSLLKRYQPHRVPSTC 319

  Fly   912 CAPIKFSSMSLIYYGDDGIIKRDLPKMVVDECGC 945
            |||:|...:|::|..:..::......|:|:||||
  Rat   320 CAPVKTKPLSMLYVDNGRVLLEHHKDMIVEECGC 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ActbetaNP_651942.2 TGFb_propeptide 370..>509 CDD:279078
TGF_beta 843..945 CDD:278448 32/110 (29%)
NodalNP_001099864.1 TGFb_propeptide 33..169 CDD:279078 7/36 (19%)
TGFB 254..353 CDD:214556 35/126 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.