DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actbeta and Bmp2

DIOPT Version :9

Sequence 1:NP_651942.2 Gene:Actbeta / 43826 FlyBaseID:FBgn0024913 Length:946 Species:Drosophila melanogaster
Sequence 2:NP_058874.2 Gene:Bmp2 / 29373 RGDID:2211 Length:394 Species:Rattus norvegicus


Alignment Length:397 Identity:90/397 - (22%)
Similarity:146/397 - (36%) Gaps:127/397 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   593 DKNRYHEGRSSIGYQPAIHNIEYENQKG------HHESFADDHENIDHED---FFGN-----TQE 643
            |..|.|.|:.  |.....|.:|....:.      |||...::...:..:.   ||.|     |.|
  Rat    80 DLYRRHSGQP--GAPAPDHRLERAASRANTVRSFHHEEAIEELPEMSGKTSRRFFFNLSSVPTDE 142

  Fly   644 IITFAEEGTQYRQYRILEFSAQNRRVPSQKLSIRSAQIHIRIDKPHSLWIEKAKSLPEKHLLNTK 708
            .:|.||                        |.|...|:                          :
  Rat   143 FLTSAE------------------------LQIFREQM--------------------------Q 157

  Fly   709 RKWGANKPHHRIKIWVF----QLSTSINITEKGIDKAIIFRASFQVDPKNLGWQKFDLTDTIREW 769
            ...|.:...|||.|:..    ..|:...:| :.:|..::.:.:.|       |:.||:|..:..|
  Rat   158 EALGNSSFQHRINIYEIIKPATASSKFPVT-RLLDTRLVTQNTSQ-------WESFDVTPAVMRW 214

  Fly   770 --YGHTSH---EKLRLLIDCTGCGGRY-----SLHLFQTSKLRGNSSDYLSTNPNRPFLV----- 819
              .|||:|   .::..|.:..|...|:     |||           .|..|.:..||.||     
  Rat   215 TAQGHTNHGFVVEVAHLEEKPGVSKRHVRISRSLH-----------QDEHSWSQVRPLLVTFGHD 268

  Fly   820 -----LHTESSRTRRVRRRAVDCGGALNGQCCKESFYVSFKALGWDDWIIAPRGYFANYCRGDCT 879
                 ||....|..:.::|.     .|...|.:...||.|..:||:|||:||.||.|.||.|:| 
  Rat   269 GKGHPLHKREKRQAKHKQRK-----RLKSSCKRHPLYVDFSDVGWNDWIVAPPGYHAFYCHGEC- 327

  Fly   880 GSFRTPDTFQTFHAHFIEEYRKMGLMNGM-----RPCCAPIKFSSMSLIYYGD-DGIIKRDLPKM 938
             .|...|...:.:...::.     |:|.:     :.||.|.:.|::|::|..: :.::.::...|
  Rat   328 -PFPLADHLNSTNHAIVQT-----LVNSVNSKIPKACCVPTELSAISMLYLDENEKVVLKNYQDM 386

  Fly   939 VVDECGC 945
            ||:.|||
  Rat   387 VVEGCGC 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ActbetaNP_651942.2 TGFb_propeptide 370..>509 CDD:279078
TGF_beta 843..945 CDD:278448 32/107 (30%)
Bmp2NP_058874.2 TGFb_propeptide 41..265 CDD:395559 51/255 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 269..291 4/26 (15%)
TGF_beta_BMP2 292..394 CDD:381660 34/109 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.