DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actbeta and Mstn

DIOPT Version :9

Sequence 1:NP_651942.2 Gene:Actbeta / 43826 FlyBaseID:FBgn0024913 Length:946 Species:Drosophila melanogaster
Sequence 2:NP_062024.1 Gene:Mstn / 29152 RGDID:3115 Length:376 Species:Rattus norvegicus


Alignment Length:427 Identity:99/427 - (23%)
Similarity:152/427 - (35%) Gaps:110/427 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   557 PIDINHSIDNKTHTGKNGEMS------HNDYEYFNDYSVQTHDKNRYHEG--------RSSIGYQ 607
            |:|:|...:.:.:..|.|..:      :..|.......:|...|.|....        |..:...
  Rat    21 PVDLNEDSEREANVEKEGLCNACAWRQNTRYSRIEAIKIQILSKLRLETAPNISKDAIRQLLPRA 85

  Fly   608 PAIHNI--EYENQKGHHESFADDHE--NIDHEDFFGNTQEIITFAEEGTQYRQYR------ILEF 662
            |.:..:  :|:.|:       ||..  :::.:|:...|:.|||...|.....|..      ..:|
  Rat    86 PPLRELIDQYDVQR-------DDSSDGSLEDDDYHATTETIITMPTESDFLMQADGKPKCCFFKF 143

  Fly   663 SAQ---NRRVPSQKLSIRSAQIHIRIDKPHSLWIE-KAKSLPEKHLLNTKRKWGANKPHHRIKIW 723
            |::   |:.|.:|                  |||. :|...|..                     
  Rat   144 SSKIQYNKVVKAQ------------------LWIYLRAVKTPTT--------------------- 169

  Fly   724 VF-QLSTSINITEKGIDKAIIFRASFQVDPKNLGWQKFDLTDTIREWYGHTSHEKLRLLIDCTGC 787
            || |:...|...:.|.....|......:.|....||..|:...::.|.....          :..
  Rat   170 VFVQILRLIKPMKDGTRYTGIRSLKLDMSPGTGIWQSIDVKTVLQNWLKQPE----------SNL 224

  Fly   788 GGRYSLHLFQTSKLRGNSSDYLSTNPN------RPFLVLHTESSRTRRVRRRAVDCG-GALNGQC 845
            |       .:...|..|..|...|.|.      .|||.:....:..|..|...:||. .:...:|
  Rat   225 G-------IEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRC 282

  Fly   846 CKESFYVSFKALGWDDWIIAPRGYFANYCRGDCTGSFRTPDTFQTF-HAHFIEEYRKMGLMNGMR 909
            |:....|.|:|.|| ||||||:.|.||||.|:|...|     .|.: |.|.:.:....|   ...
  Rat   283 CRYPLTVDFEAFGW-DWIIAPKRYKANYCSGECEFVF-----LQKYPHTHLVHQANPRG---SAG 338

  Fly   910 PCCAPIKFSSMSLIYY-GDDGIIKRDLPKMVVDECGC 945
            |||.|.|.|.::::|: |.:.||...:|.||||.|||
  Rat   339 PCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGC 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ActbetaNP_651942.2 TGFb_propeptide 370..>509 CDD:279078
TGF_beta 843..945 CDD:278448 41/103 (40%)
MstnNP_062024.1 TGFb_propeptide 37..250 CDD:413528 45/275 (16%)
TGF_beta_GDF8 269..376 CDD:381658 45/116 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.