DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actbeta and BMP10

DIOPT Version :9

Sequence 1:NP_651942.2 Gene:Actbeta / 43826 FlyBaseID:FBgn0024913 Length:946 Species:Drosophila melanogaster
Sequence 2:NP_055297.1 Gene:BMP10 / 27302 HGNCID:20869 Length:424 Species:Homo sapiens


Alignment Length:434 Identity:104/434 - (23%)
Similarity:154/434 - (35%) Gaps:132/434 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   610 IHNIEYENQKGHHESFADDHENIDHEDFFGNTQEIITFAEEGTQYRQYRILEFSAQNRRVPSQKL 674
            |.|:|....:.....|.|.....|..||  ||                 :|: |.::..:.:..|
Human    24 IMNLEQSPLEEDMSLFGDVFSEQDGVDF--NT-----------------LLQ-SMKDEFLKTLNL 68

  Fly   675 SIRSAQIHIRIDKP------HSLWIEKAKSLPEKHLL---------------NTKRKW----GAN 714
            |....|...::|.|      ::.:.....|:|..:::               |..||:    ..:
Human    69 SDIPTQDSAKVDPPEYMLELYNKFATDRTSMPSANIIRSFKNEDLFSQPVSFNGLRKYPLLFNVS 133

  Fly   715 KPHHR----IKIWVFQLSTSINITEKGIDKAI-IFR-----------------ASFQVDPKNLGW 757
            .|||.    .::.::.|.....:...|:|:.| ||.                 .|.::...|..|
Human   134 IPHHEEVIMAELRLYTLVQRDRMIYDGVDRKITIFEVLESKGDNEGERNMLVLVSGEIYGTNSEW 198

  Fly   758 QKFDLTDTIREWY--GHTSHE----------------KLRLLIDCTGCGGRYS--LHLF------ 796
            :.||:||.||.|.  |.::|:                ..||.|| |....:::  |.:|      
Human   199 ETFDVTDAIRRWQKSGSSTHQLEVHIESKHDEAEDASSGRLEID-TSAQNKHNPLLIVFSDDQSS 262

  Fly   797 ---------------QTSKLRGNSSDYLSTNPNRPFLVLHTESS----RTRRVRRRAVDCGGALN 842
                           |..:|.....|..|:.|....| |...|:    .|.|:||.|       .
Human   263 DKERKEELNEMISHEQLPELDNLGLDSFSSGPGEEAL-LQMRSNIIYDSTARIRRNA-------K 319

  Fly   843 GQCCKES-FYVSFKALGWDDWIIAPRGYFANYCRGDCT---GSFRTPDTFQTFHAHFIEEYRKMG 903
            |..||.: .|:.||.:|||.|||||.||.|..|||.|.   ....||    |.||..........
Human   320 GNYCKRTPLYIDFKEIGWDSWIIAPPGYEAYECRGVCNYPLAEHLTP----TKHAIIQALVHLKN 380

  Fly   904 LMNGMRPCCAPIKFSSMSLIYYGDDGII--KRDLPKMVVDECGC 945
            .....:.||.|.|...:|::|. |.|::  |.....|.|.||||
Human   381 SQKASKACCVPTKLEPISILYL-DKGVVTYKFKYEGMAVSECGC 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ActbetaNP_651942.2 TGFb_propeptide 370..>509 CDD:279078
TGF_beta 843..945 CDD:278448 39/107 (36%)
BMP10NP_055297.1 TGFb_propeptide 55..256 CDD:279078 39/202 (19%)
TGF_beta 321..423 CDD:278448 38/106 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.