DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actbeta and GDF2

DIOPT Version :9

Sequence 1:NP_651942.2 Gene:Actbeta / 43826 FlyBaseID:FBgn0024913 Length:946 Species:Drosophila melanogaster
Sequence 2:NP_057288.1 Gene:GDF2 / 2658 HGNCID:4217 Length:429 Species:Homo sapiens


Alignment Length:403 Identity:84/403 - (20%)
Similarity:142/403 - (35%) Gaps:148/403 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   669 VPSQKLSIRSAQIHIRIDKPHSLWI------EKAKSLPEKHLLNTKRKWGANK---PHHRIKIWV 724
            :|....:::....::::|...||.:      :|.:..|.:::::...::.::|   |...| :..
Human    48 LPEHTFNLKMFLENVKVDFLRSLNLSGVPSQDKTRVEPPQYMIDLYNRYTSDKSTTPASNI-VRS 111

  Fly   725 FQLSTSINIT-------EKGIDKAIIFRASF-------------------QVDP----------- 752
            |.:..:|:||       :|.|   ::|..|.                   .|||           
Human   112 FSMEDAISITATEDFPFQKHI---LLFNISIPRHEQITRAELRLYVSCQNHVDPSHDLKGSVVIY 173

  Fly   753 ------------------------KNLGWQKFDLTDTIREWY---GHTSHEKLRLLIDC--TGCG 788
                                    ::.||:..:::..::.|.   ...|..||.:.::.  .||.
Human   174 DVLDGTDAWDSATETKTFLVSQDIQDEGWETLEVSSAVKRWVRSDSTKSKNKLEVTVESHRKGCD 238

  Fly   789 --------GRYSLHLF-------------------------QTSKLR----------GNSSDYLS 810
                    |..:|..|                         |.|.|:          |.||....
Human   239 TLDISVPPGSRNLPFFVVFSNDHSSGTKETRLELREMISHEQESVLKKLSKDGSTEAGESSHEED 303

  Fly   811 TNPNRPFLVLHTESSRTRRVRRRAVDCGGALNGQCCKESFYVSFKALGWDDWIIAPRGYFANYCR 875
            |:.       |..:..|...|:|:...|    ..|.|.|..|:|:.:|||.|||||:.|.|..|:
Human   304 TDG-------HVAAGSTLARRKRSAGAG----SHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECK 357

  Fly   876 GDCTGSFRTPDTFQTFHA------HFIEEYRKMGLMNGMRPCCAPIKFSSMSLIYYGDDGI--IK 932
            |.|.... ..|...|.||      | ::...|:|     :.||.|.|.|.:|::|..|.|:  :|
Human   358 GGCFFPL-ADDVTPTKHAIVQTLVH-LKFPTKVG-----KACCVPTKLSPISVLYKDDMGVPTLK 415

  Fly   933 RDLPKMVVDECGC 945
            .....|.|.||||
Human   416 YHYEGMSVAECGC 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ActbetaNP_651942.2 TGFb_propeptide 370..>509 CDD:279078
TGF_beta 843..945 CDD:278448 39/109 (36%)
GDF2NP_057288.1 TGFb_propeptide 76..257 CDD:279078 27/184 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 283..308 5/31 (16%)
TGF_beta 326..428 CDD:278448 39/108 (36%)
Interaction with ENG. /evidence=ECO:0000269|PubMed:28564608 402..416 4/13 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.