DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Actbeta and GDF1

DIOPT Version :9

Sequence 1:	NP_651942.2	Gene:	Actbeta / 43826	FlyBaseID:	FBgn0024913	Length:	946	Species:	Drosophila melanogaster
Sequence 2:	NP_001374367.1	Gene:	GDF1 / 2657	HGNCID:	4214	Length:	372	Species:	Homo sapiens

Alignment Length:	131	Identity:	49/131 - (37%)
Similarity:	64/131 - (48%)	Gaps:	23/131 - (17%)

- Green bases have known domain annotations that are detailed below.

  Fly   829 RVRRRAVD-CGGALNGQCCKESFYVSFKALGWDDWIIAPRGYFANYCRGDC------TGSFRTPD 886
            |.||.|.. .||...|.|.....||||:.:||..|:|||||:.||||:|.|      :||...|
Human   250 RPRRDAEPVLGGGPGGACRARRLYVSFREVGWHRWVIAPRGFLANYCQGQCALPVALSGSGGPP- 313

  Fly   887 TFQTFHAHFIEEYRKMGLMNGMR------PCCAPIKFSSMSLIYY-GDDGIIKRDLPKMVVDECG 944
              ...||..      ..||:...      |||.|.:.|.:|:::: ..|.::.|....|||||||
Human   314 --ALNHAVL------RALMHAAAPGAADLPCCVPARLSPISVLFFDNSDNVVLRQYEDMVVDECG 370

  Fly   945 C 945
            |
Human   371 C 371

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Actbeta	NP_651942.2	TGFb_propeptide	370..>509	CDD:279078
Actbeta	NP_651942.2	TGF_beta	843..945	CDD:278448	41/114 (36%)
GDF1	NP_001374367.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	67..86
GDF1	NP_001374367.1	TGF_beta_GDF1_3_like	267..372	CDD:381642	42/114 (37%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3900
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.810