DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actbeta and Tgfb3

DIOPT Version :9

Sequence 1:NP_651942.2 Gene:Actbeta / 43826 FlyBaseID:FBgn0024913 Length:946 Species:Drosophila melanogaster
Sequence 2:NP_037306.1 Gene:Tgfb3 / 25717 RGDID:3851 Length:412 Species:Rattus norvegicus


Alignment Length:480 Identity:111/480 - (23%)
Similarity:176/480 - (36%) Gaps:131/480 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   512 IASMPIELKSHHNSSPKELKSGAVRK--VNGINGTQMNENALKKSTYPIDINH------SIDNKT 568
            :|::.:.|     |:...|..|.::|  |..|.|..:::..|.....|..:.|      ::.|.|
  Rat    17 LATVSLSL-----STCTTLDFGHIKKKRVEAIRGQILSKLRLTSPPEPSVMTHVPYQVLALYNST 76

  Fly   569 HTGKNGEMSHNDYEYFNDYSVQTHDKNRYHEGRSSIGYQPAIHNIEYENQKGHHESFADDHENID 633
            .  :..|..|.:.|   :...|...::.|        |...||..:.......|...|...:.|.
  Rat    77 R--ELLEEMHGERE---EGCTQETSESEY--------YAKEIHKFDMIQGLAEHNELAVCPKGIT 128

  Fly   634 HEDFFGNTQEIITFAEEGTQ-YR-QYRILEFSAQNRRVPSQKLSIRSAQIHIRIDKPHSLWIEKA 696
            .:.|..|...:   .:.||. :| ::|:|       |||:.. |.|:.|   ||:....|     
  Rat   129 SKVFRFNVSSV---EKNGTNLFRAEFRVL-------RVPNPS-SKRTEQ---RIELFQIL----- 174

  Fly   697 KSLPEKHLLNTKRKWGANKPHHRIKIWVFQLSTSINITEKGIDKAIIFRASFQVDPKNLGWQKFD 761
              .|::|:...:...|.|.|                  .:|..:                |..||
  Rat   175 --RPDEHIAKQRYIGGKNLP------------------TRGTAE----------------WLSFD 203

  Fly   762 LTDTIREW-YGHTSHEKLRLLIDCTGCGGRYSLHLFQTS-------------KLRG--NSSDY-- 808
            :|||:||| ....|:..|.:.|.|. |      |.||.:             |.:|  |..|:  
  Rat   204 VTDTVREWLLRRESNLGLEISIHCP-C------HTFQPNGDILENVHEVMEIKFKGVDNEDDHGR 261

  Fly   809 -------LSTNPNRPFLVL-----HTESS--RTRRVRRRAVD---CGGALNGQCCKESFYVSFKA 856
                   ...:.:.|.|:|     |...|  :..:.::||:|   |...|...||....|:.|:.
  Rat   262 GDLGRLKKQKDHHNPHLILMMIPPHRLDSPGQGGQRKKRALDTNYCFRNLEENCCVRPLYIDFRQ 326

  Fly   857 -LGWDDWIIAPRGYFANYCRGDCTGSFRTPDTFQTFHAHFIEEYRKMGLMNGMRPCCAPIKFSSM 920
             ||| .|:..|:||:||:|.|.|. ..|:.|   |.|:..:..|..:.......|||.|.....:
  Rat   327 DLGW-KWVHEPKGYYANFCSGPCP-YLRSSD---TTHSTVLGLYNTLNPEASASPCCVPQDLEPL 386

  Fly   921 SLIYYGDDGIIKRDLPKMVVDECGC 945
            :::||.........|..|||..|.|
  Rat   387 TILYYVGRTPKVEQLSNMVVKSCKC 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ActbetaNP_651942.2 TGFb_propeptide 370..>509 CDD:279078
TGF_beta 843..945 CDD:278448 32/102 (31%)
Tgfb3NP_037306.1 TGFb_propeptide 24..230 CDD:395559 60/285 (21%)
Cell attachment site. /evidence=ECO:0000250|UniProtKB:P01137 261..263 0/1 (0%)
TGF_beta_TGFB3 312..412 CDD:381656 33/105 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11848
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.