DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actbeta and Bmp6

DIOPT Version :9

Sequence 1:NP_651942.2 Gene:Actbeta / 43826 FlyBaseID:FBgn0024913 Length:946 Species:Drosophila melanogaster
Sequence 2:XP_038951315.1 Gene:Bmp6 / 25644 RGDID:2214 Length:535 Species:Rattus norvegicus


Alignment Length:648 Identity:135/648 - (20%)
Similarity:215/648 - (33%) Gaps:265/648 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   374 IKRQILTKLGLSHKPNVSHPLPKQFIWETIYRVDGGRMIPNNAFGSSGKNLDQKTIKLRAFASPG 438
            ::::||:.|||.|:|...|.|.:                |.:..      |.|:.          
  Rat    76 MQKEILSVLGLPHRPRPLHGLQQ----------------PQSPV------LPQQQ---------- 108

  Fly   439 SHLFNGRGGRTDQRSERDPSHHKYRSPFDFTFNISKNNVYGKVLRNRSLERIDKKNSFLNGWTEN 503
                     ::.|.:..:|...:.:|...|..::           ..||.:.|::    :|.:|.
  Rat   109 ---------QSQQTAREEPPPGRLKSAPLFMLDL-----------YNSLSKDDEE----DGVSEG 149

  Fly   504 RQLKINSQIASMPIELKSHHNSSPKELKS---GAVRKVNGINGTQMNENALKKSTYPIDINHSID 565
            ..|           |.:||..:|..:||.   ||.                          ||::
  Rat   150 EGL-----------EPESHGRASSSQLKQPSPGAA--------------------------HSLN 177

  Fly   566 NKT--HTGKNGE----MSHNDYEYFND-------YSVQTHDKNRYHEGRSSIGYQPAIHNIEYEN 617
            .|:  ..|..|.    .|..|..:.||       .::..:||                   |:..
  Rat   178 RKSLLAPGPGGSASPLTSAQDSAFLNDADMVMSFVNLVEYDK-------------------EFSP 223

  Fly   618 QKGHHESFADDHENIDHEDFFGNTQEIITFAEEGTQYRQYR---ILEFSAQNRRVPSQKLSIRSA 679
            ::.||:.|..:...|..       .|.:|.||    :|.|:   :..|..|...:...::    .
  Rat   224 RQRHHKEFKFNLSQIPE-------GEAVTAAE----FRVYKDCVVGSFKNQTFLISIYQV----L 273

  Fly   680 QIHIRIDKPHSLWIEKAKSLPEKHLLNTKRKWGANKPHHRIKIWVFQLSTSINITEKGIDKAIIF 744
            |.|...|.             :..||:|:..|.:.:                             
  Rat   274 QEHQHRDS-------------DLFLLDTRVVWASEE----------------------------- 296

  Fly   745 RASFQVDPKNLGWQKFDLTDTIREWYGHTSHEK-LRLLIDCTGCGGRYSLHLF-QTSKLRGNSSD 807
                       ||.:||:|.|...|.....|.. |:|.:..     |..||:. :.:.|.|....
  Rat   297 -----------GWLEFDITATSNLWVVTPQHNMGLQLSVVT-----RDGLHINPRAAGLVGRDGP 345

  Fly   808 YLSTNPNRPFLV-------LHTESSRTRRVRRR------------------AVDCGGA-LNGQCC 846
            |    ..:||:|       :|..::|:...|||                  |.|...: |...|.
  Rat   346 Y----DKQPFMVAFFKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVSRGSSASDYNSSELKTACK 406

  Fly   847 KESFYVSFKALGWDDWIIAPRGYFANYCRGDCT--------------------------GSFRTP 885
            |...||||:.|||.||||||:||.||||.|:|:                          |....|
  Rat   407 KHELYVSFQDLGWQDWIIAPKGYAANYCDGECSFPLNAHMNATNHAIVQTLVSALTWLVGPGLDP 471

  Fly   886 DTFQTF--HAHFIEEYRKMGLMNGMRPCCAPIKFSSMSLIYYGDD-GIIKRDLPKMVVDECGC 945
            .:|.|.  ||..:|:...|......:|||||.|.:::|::|:.|: .:|.:....|||..|||
  Rat   472 VSFLTVSSHASLLEQVHLMNPEYVPKPCCAPTKLNAISVLYFDDNSNVILKKYRNMVVRACGC 534

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ActbetaNP_651942.2 TGFb_propeptide 370..>509 CDD:279078 22/134 (16%)
TGF_beta 843..945 CDD:278448 45/130 (35%)
Bmp6XP_038951315.1 TGFb_propeptide 58..355 CDD:395559 80/467 (17%)
TGF_beta_BMP6 404..535 CDD:381666 47/131 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.