DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actbeta and Amh

DIOPT Version :9

Sequence 1:NP_651942.2 Gene:Actbeta / 43826 FlyBaseID:FBgn0024913 Length:946 Species:Drosophila melanogaster
Sequence 2:NP_037034.1 Gene:Amh / 25378 RGDID:2108 Length:553 Species:Rattus norvegicus


Alignment Length:142 Identity:41/142 - (28%)
Similarity:57/142 - (40%) Gaps:13/142 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   812 NPNRPFLVLHTESS-----RTRRVRRRA-VDCGGALNGQCCKESFYVSFKALGWDDWIIAPRGYF 870
            :|.|..|:|.....     |.|..|.|| ...|...:|.|......|..:|   :..::.|..|.
  Rat   416 DPLRALLLLKALQGLRAEWRGREGRGRAGRSKGTGTDGLCALRELSVDLRA---ERSVLIPETYQ 477

  Fly   871 ANYCRGDCT--GSFRTPDTFQTFHAHFIEEYRKMGLMNGMRPCCAPIKFSSMSLIYYGDDGIIKR 933
            ||.|:|.|.  .|.|.|....  |...:.:.:..|...|..|||.|..::...||...::.|...
  Rat   478 ANNCQGACAWPQSDRNPRYGN--HVVLLLKMQARGAALGRLPCCVPTAYTGKLLISLSEEHISAH 540

  Fly   934 DLPKMVVDECGC 945
            .:|.||..||||
  Rat   541 HVPNMVATECGC 552

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
ActbetaNP_651942.2 TGFb_propeptide 370..>509 CDD:279078
TGF_beta 843..945 CDD:278448 29/103 (28%)