DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actbeta and Bmp4

DIOPT Version :9

Sequence 1:NP_651942.2 Gene:Actbeta / 43826 FlyBaseID:FBgn0024913 Length:946 Species:Drosophila melanogaster
Sequence 2:NP_036959.2 Gene:Bmp4 / 25296 RGDID:2213 Length:408 Species:Rattus norvegicus


Alignment Length:401 Identity:92/401 - (22%)
Similarity:150/401 - (37%) Gaps:111/401 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   582 EYFND-YSVQTHDKNRYHEGRSSIGYQPAIHNIEYENQKGHHESFADDHENIDHEDFFGNTQEII 645
            :|..| |.:|:.::....:.:.:        .:||..:..   |.|:...:..||:...|    |
  Rat    81 DYMRDLYRLQSGEEEEEEQSQGT--------GLEYPERPA---SRANTVRSFHHEEHLEN----I 130

  Fly   646 TFAEEGTQYRQYRILEFSAQNRRVPSQKLSIRSAQIHIRIDKP---HSLWIEKAKSLPEK----H 703
            ....|.:.:|.:..|....:|..:.|.:|.:...|:....|..   |.:.|.:....|.:    |
  Rat   131 PGTSESSAFRFFFNLSSIPENEVISSAELRLFREQVDQGPDWEQGFHRINIYEVMKPPAEMVPGH 195

  Fly   704 LLNTKRKWGANKPHHRIKIWVFQLSTSINITEKGIDKAIIFRASFQVDPKNLGWQKFDLTDTIRE 768
            |:.  |.......||             |:|.                     |:.||::..:..
  Rat   196 LIT--RLLDTRLVHH-------------NVTR---------------------WETFDVSPAVLR 224

  Fly   769 W-------YGHTSHEKLRLLIDCTGCGGRYSLHLFQTSKLRGNSSDYLSTNPN--------RPFL 818
            |       ||        |.|:.|        ||.||...:|.......:.|.        ||.|
  Rat   225 WTREKQPNYG--------LAIEVT--------HLHQTRTHQGQHVRISRSLPQGSGNWAQLRPLL 273

  Fly   819 VLHTESSR----TRRVRRRA----VDCGGALNGQCCKESFYVSFKALGWDDWIIAPRGYFANYCR 875
            |......|    |||..:|:    .......|..|.:.|.||.|..:||:|||:||.||.|.||.
  Rat   274 VTFGHDGRGHTLTRRRAKRSPKHHPQRSRKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCH 338

  Fly   876 GDCTGSFRTPDTFQTFHAHFIEEYRKMGLMNGM-----RPCCAPIKFSSMSLIYYGD-DGIIKRD 934
            |||  .|...|...:.:...::.     |:|.:     :.||.|.:.|::|::|..: |.::.::
  Rat   339 GDC--PFPLADHLNSTNHAIVQT-----LVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKN 396

  Fly   935 LPKMVVDECGC 945
            ..:|||:.|||
  Rat   397 YQEMVVEGCGC 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ActbetaNP_651942.2 TGFb_propeptide 370..>509 CDD:279078
TGF_beta 843..945 CDD:278448 35/107 (33%)
Bmp4NP_036959.2 TGFb_propeptide 41..276 CDD:395559 49/261 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 91..113 2/32 (6%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 281..307 6/25 (24%)
TGF_beta_BMP4_BMP2B 302..408 CDD:381661 38/113 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.