DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actbeta and Gdf6

DIOPT Version :9

Sequence 1:NP_651942.2 Gene:Actbeta / 43826 FlyBaseID:FBgn0024913 Length:946 Species:Drosophila melanogaster
Sequence 2:NP_001013056.1 Gene:Gdf6 / 252834 RGDID:620104 Length:452 Species:Rattus norvegicus


Alignment Length:479 Identity:104/479 - (21%)
Similarity:170/479 - (35%) Gaps:146/479 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   554 STYPIDINHSIDNKTHTGKNGEMSHNDYEYFNDYSVQTHDKNRYHEGR-----SSIGYQPAIHN- 612
            |:..:|....::|:    |.|:|.....|.....:.:.| :.|.:|.|     .|:|.:|.... 
  Rat    32 SSTELDSTKDVENR----KGGKMQRTPQESAEGRTPKEH-RPRPNELRRRLPGQSLGQEPPGRGP 91

  Fly   613 --IEYENQKGHHESFADDHENIDHEDFFGNTQE---IITFAEEG------TQYRQYRILEFSAQN 666
              :.:|.....:.:::...:...:..||.:::.   |.:|.:.|      |..|:.:.| |....
  Rat    92 RVVPHEYMLSIYRTYSIAEKLGINASFFQSSKSANTITSFVDRGLDDLSHTPLRRQKYL-FDVST 155

  Fly   667 RRVPSQKLSIRSAQIHIRIDKPHSLWIEKAKSLPEKHLLNTKRKWGANKPHHRIKIWVFQLSTSI 731
            .   |.|..:..|::.:....|.:.|..:.:.|   ||                  .:|...:.:
  Rat   156 L---SDKEELVGAELRLYRQAPPTPWGPQTRPL---HL------------------QLFPCLSPL 196

  Fly   732 NITEKGIDKAIIFRASFQVDPKNLGWQKFDLTDTIREWYGHTSHEKLRLL---IDCTGCGGRYSL 793
            .:..:.:|..         .|...||:.||:...:|.........:||.:   :|....|.|   
  Rat   197 LLDSRTLDPQ---------GPTEAGWEVFDVWQVLRPQPWKQLCLELRAVWGELDARDSGAR--- 249

  Fly   794 HLFQTSKLRGNSS----DYLSTN--------PNRPFLVLHTESSRT------------------- 827
                   .||...    |..|..        ..|..||:.|.|.|.                   
  Rat   250 -------PRGPQQSPPLDLRSLGFGRRVRPPQERALLVVFTRSQRKNLFTEMHEQLGSAEAAGAE 307

  Fly   828 --------------------RRVRRRAVDC-GGALNG-----QCCKESFYVSFKALGWDDWIIAP 866
                                ||.||.|:.. .|..:|     :|.::..:|:||.||||||||||
  Rat   308 GSWPAPSGAPDAGSWLPSPGRRRRRTALSSRHGKRHGKKSRLRCSRKPLHVNFKELGWDDWIIAP 372

  Fly   867 RGYFANYCRGDCTGSFRT---PDTFQTFHAHFIEEYRKMGLMNGMRP------CCAPIKFSSMSL 922
            ..|.|.:|.|.|....|:   |    |.|| .|:.     |||.|.|      ||.|.|.:.:|:
  Rat   373 LEYEAYHCEGVCDFPLRSHLEP----TNHA-IIQT-----LMNSMDPGSTPPSCCVPTKLTPISI 427

  Fly   923 IYY-GDDGIIKRDLPKMVVDECGC 945
            :|. ..:.::.:....|||:.|||
  Rat   428 LYIDAGNNVVYKQYEDMVVESCGC 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ActbetaNP_651942.2 TGFb_propeptide 370..>509 CDD:279078
TGF_beta 843..945 CDD:278448 41/116 (35%)
Gdf6NP_001013056.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 29..93 14/65 (22%)
TGFb_propeptide 66..282 CDD:279078 45/260 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 244..267 6/32 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 301..348 7/46 (15%)
TGF_beta 350..451 CDD:278448 40/110 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.