DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actbeta and Gdf7

DIOPT Version :9

Sequence 1:NP_651942.2 Gene:Actbeta / 43826 FlyBaseID:FBgn0024913 Length:946 Species:Drosophila melanogaster
Sequence 2:XP_006239940.1 Gene:Gdf7 / 252833 RGDID:620105 Length:456 Species:Rattus norvegicus


Alignment Length:290 Identity:73/290 - (25%)
Similarity:110/290 - (37%) Gaps:93/290 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   735 EKGIDKAIIFRASFQVDPKNLGWQKFDLTDTI---REW--------------------------- 769
            |.|....:..||:..:|  :..|:.||:||.:   |.|                           
  Rat   180 EAGTAHLLHSRAAEPLD--SARWEAFDVTDAVQSHRRWPRTSRKFCLVLRAVTGAESSPLALRRL 242

  Fly   770 ---------YGHTSHEKLRLLIDCTGCGGRYSLHLFQTSKLRGNSSDYLSTNPNRPFLVLHTESS 825
                     .|.|:.|:..||:..:....:.|  ||:..:.:..:....:..|..|.|...:..:
  Rat   243 GFGWPGGGDGGGTAAEERALLVISSRTHRKES--LFREIRAQARALRAAAELPPDPGLGAGSRKA 305

  Fly   826 RT--RRVRRRAV---------------------DCGGALNG-------QCCKESFYVSFKALGWD 860
            ..  ||.||.|:                     ..|||..|       :|.::..:|.||.||||
  Rat   306 TPGGRRRRRTALAGTRGAQGSGGGGGGGGGGGGGGGGAGRGHGRRGRSRCSRKPLHVDFKELGWD 370

  Fly   861 DWIIAPRGYFANYCRGDCTGSFRT---PDTFQTFHAHFIEEYRKMGLMNGMRP------CCAPIK 916
            ||||||..|.|.:|.|.|....|:   |    |.|| .|:.     |:|.|.|      ||.|.:
  Rat   371 DWIIAPLDYEAYHCEGVCDFPLRSHLEP----TNHA-IIQT-----LLNSMAPDAAPASCCVPAR 425

  Fly   917 FSSMSLIYY-GDDGIIKRDLPKMVVDECGC 945
            .|.:|::|. ..:.::.:....|||:.|||
  Rat   426 LSPISILYIDAANNVVYKQYEDMVVEACGC 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ActbetaNP_651942.2 TGFb_propeptide 370..>509 CDD:279078
TGF_beta 843..945 CDD:278448 40/118 (34%)
Gdf7XP_006239940.1 TGFb_propeptide <87..230 CDD:279078 12/51 (24%)
TGF_beta 358..455 CDD:278448 38/106 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.