Sequence 1: | NP_651942.2 | Gene: | Actbeta / 43826 | FlyBaseID: | FBgn0024913 | Length: | 946 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006239940.1 | Gene: | Gdf7 / 252833 | RGDID: | 620105 | Length: | 456 | Species: | Rattus norvegicus |
Alignment Length: | 290 | Identity: | 73/290 - (25%) |
---|---|---|---|
Similarity: | 110/290 - (37%) | Gaps: | 93/290 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 735 EKGIDKAIIFRASFQVDPKNLGWQKFDLTDTI---REW--------------------------- 769
Fly 770 ---------YGHTSHEKLRLLIDCTGCGGRYSLHLFQTSKLRGNSSDYLSTNPNRPFLVLHTESS 825
Fly 826 RT--RRVRRRAV---------------------DCGGALNG-------QCCKESFYVSFKALGWD 860
Fly 861 DWIIAPRGYFANYCRGDCTGSFRT---PDTFQTFHAHFIEEYRKMGLMNGMRP------CCAPIK 916
Fly 917 FSSMSLIYY-GDDGIIKRDLPKMVVDECGC 945 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Actbeta | NP_651942.2 | TGFb_propeptide | 370..>509 | CDD:279078 | |
TGF_beta | 843..945 | CDD:278448 | 40/118 (34%) | ||
Gdf7 | XP_006239940.1 | TGFb_propeptide | <87..230 | CDD:279078 | 12/51 (24%) |
TGF_beta | 358..455 | CDD:278448 | 38/106 (36%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3900 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.900 |