DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actbeta and Inhbb

DIOPT Version :9

Sequence 1:NP_651942.2 Gene:Actbeta / 43826 FlyBaseID:FBgn0024913 Length:946 Species:Drosophila melanogaster
Sequence 2:NP_542949.1 Gene:Inhbb / 25196 RGDID:2913 Length:411 Species:Rattus norvegicus


Alignment Length:403 Identity:115/403 - (28%)
Similarity:174/403 - (43%) Gaps:105/403 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   559 DINHSID--------NKTHTGKNGEMSHNDYEYFNDYSVQTHDKNRYHEGRSSIGYQPAIHNIEY 615
            :|.|::.        .|.|.||..|                       :||           :|.
  Rat    97 NITHAVPKAAMVTALRKLHAGKVRE-----------------------DGR-----------VEI 127

  Fly   616 ENQKGHHESFADDHENIDHEDFFGNTQEIITFAE-EGTQYRQYRILEFSAQNRRVPSQKLSIRSA 679
            .:..||....||..|.:         .|||:||| :|....:.|:..|.:..   .:|.|.:..|
  Rat   128 PHLDGHASPGADGQERV---------SEIISFAETDGLASSRVRLYFFVSNE---GNQNLFVVQA 180

  Fly   680 QIHIRIDKPHSLWIEKAKSLPEKHLLNTKRKWGANKPHHRIKIWVFQ---LSTSINITEKGIDKA 741
                      |||: ..|.||......::||       .|:|:: ||   .....|:.||     
  Rat   181 ----------SLWL-YLKLLPYVLEKGSRRK-------VRVKVY-FQEQGHGDRWNVVEK----- 221

  Fly   742 IIFRASFQVDPKNLGWQKFDLTDTIREWYGHTSHEKLRLLIDCTGCGGRYSLHLFQTSKLRGNSS 806
                   :||.|..||..|.:|:.|:..: .....:|.|.:.|..|.....:.:|...   |..|
  Rat   222 -------KVDLKRSGWHTFPITEAIQALF-ERGERRLNLDVQCDSCQELAVVPVFVDP---GEES 275

  Fly   807 DYLSTNPNRPFLVLHTESSRTR-RVRRRAVDCGGALNGQCCKESFYVSFKALGWDDWIIAPRGYF 870
                   :|||:|:......:| |:|:|.::|.|. ...||::.|::.|:.:||:||||||.||:
  Rat   276 -------HRPFVVVQARLGDSRHRIRKRGLECDGR-TSLCCRQQFFIDFRLIGWNDWIIAPTGYY 332

  Fly   871 ANYCRGDCTGSFR-TPDTFQTFHAHFIEEYRKMGLMNG-MRPCCAPIKFSSMSLIYYGDD-GIIK 932
            .|||.|.|..... .|.:..:||...:.:||..||..| :..||.|.|.||||::|:.|: .|:|
  Rat   333 GNYCEGSCPAYLAGVPGSASSFHTAVVNQYRMRGLNPGPVNSCCIPTKLSSMSMLYFDDEYNIVK 397

  Fly   933 RDLPKMVVDECGC 945
            ||:|.|:|:||||
  Rat   398 RDVPNMIVEECGC 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ActbetaNP_651942.2 TGFb_propeptide 370..>509 CDD:279078
TGF_beta 843..945 CDD:278448 46/104 (44%)
InhbbNP_542949.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..69
TGFb_propeptide 73..282 CDD:413528 60/272 (22%)
TGF_beta_INHBB 305..411 CDD:381675 48/106 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 118 1.000 Domainoid score I5700
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 180 1.000 Inparanoid score I3898
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1385831at2759
OrthoFinder 1 1.000 - - FOG0000887
OrthoInspector 1 1.000 - - otm45057
orthoMCL 1 0.900 - - OOG6_109477
Panther 1 1.100 - - O PTHR11848
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X477
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.970

Return to query results.
Submit another query.