DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actbeta and Inha

DIOPT Version :9

Sequence 1:NP_651942.2 Gene:Actbeta / 43826 FlyBaseID:FBgn0024913 Length:946 Species:Drosophila melanogaster
Sequence 2:NP_036722.1 Gene:Inha / 24504 RGDID:2912 Length:366 Species:Rattus norvegicus


Alignment Length:402 Identity:83/402 - (20%)
Similarity:127/402 - (31%) Gaps:149/402 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   605 GYQPAIHNIEYENQKG--HHESFADDHENIDHEDFF--------------GNTQEIITFAEEGTQ 653
            |..|.|..:...:..|  .|.:...:.|::.....|              |..||    .|||..
  Rat    52 GGGPGIRRLPRRHALGGFMHRTSEPEEEDVSQAILFPATGATCEDQAAAGGLAQE----PEEGLF 112

  Fly   654 YRQYRILEFSAQNRRVPSQKLSIRSAQIHIRIDKPHSLWIEKAKSLPEKHLLNTKRKW---GANK 715
            ...:|           |||         |||                 .|.:.:.:.|   |.::
  Rat   113 TYVFR-----------PSQ---------HIR-----------------SHQVTSAQLWFHTGLDR 140

  Fly   716 PHHRIKIWVFQLSTSINITEKGIDKAIIFRASFQVDPKNLG-----WQKFDLTDTIREWYGHTSH 775
                      :.:.:.|.:...:|..::........|.:||     |....|..:.   :...:|
  Rat   141 ----------KSTAASNSSRPLLDLLVLSSGGPMAVPVSLGQSPPRWAVLHLAASA---FPLLTH 192

  Fly   776 EKLRLLIDC--TGCGGRYSLHLFQTSKLRGNSSDYLSTNPNRPFLVLHTES---SRTRRVRRRAV 835
            ..|.||:.|  ..|.||                     ....||||.||.:   |...|.||.|.
  Rat   193 PILVLLLRCPLCSCSGR---------------------PETTPFLVAHTRARAPSAGERARRSAP 236

  Fly   836 D-----CGGAL------------NGQCCKESFYVSFKALGWDDWIIAPRGYFANYCRGDC----- 878
            .     ...||            :..|.:.:..:||:.||||.||:.|..:..:||.|.|     
  Rat   237 SMPWPWSPAALRLLQRPPEEPSAHAFCHRAALNISFQELGWDRWIVHPPSFIFHYCHGSCGMPTS 301

  Fly   879 ------TGSFRTPDTFQTFHAHFIEEYRKMGLMNGMRPCCAPIKFSSMSL-IYYGDDG--IIKRD 934
                  .|:..||             .:.:.|:.|.:||||.:..|..|| :....||  ..|.:
  Rat   302 DLPLPVPGAPPTP-------------AQPLFLVPGAKPCCAALPGSMRSLRVRTTSDGGYSFKYE 353

  Fly   935 L-PKMVVDECGC 945
            : |.::...|.|
  Rat   354 MVPNLITQHCAC 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ActbetaNP_651942.2 TGFb_propeptide 370..>509 CDD:279078
TGF_beta 843..945 CDD:278448 31/116 (27%)
InhaNP_036722.1 TGFB 263..366 CDD:214556 32/116 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11848
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.