DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actbeta and Nodal

DIOPT Version :9

Sequence 1:NP_651942.2 Gene:Actbeta / 43826 FlyBaseID:FBgn0024913 Length:946 Species:Drosophila melanogaster
Sequence 2:NP_038639.2 Gene:Nodal / 18119 MGIID:97359 Length:354 Species:Mus musculus


Alignment Length:284 Identity:62/284 - (21%)
Similarity:107/284 - (37%) Gaps:78/284 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   669 VPSQKLSIRSAQIHIRIDKPHSLWIEKAKSLPEKHLLNTKRKWGANKPHHRIKIWVFQLSTSINI 733
            :||| ::..|....:.:.||.|.|::..::|.::.....::.|     |......|...||::  
Mouse   141 IPSQ-VTFASGSTVLEVTKPLSKWLKDPRALEKQVSSRAEKCW-----HQPYTPPVPVASTNV-- 197

  Fly   734 TEKGIDKAIIFRASFQVDPKNLGWQKFDLTDTIREWYGHTSHEKLRLLIDCTGCGGRYSLHLFQT 798
                    ::..::...:.:.||.... |.:....|..    ::.:|.::..|.|.|...|..  
Mouse   198 --------LMLYSNRPQEQRQLGGATL-LWEAESSWRA----QEGQLSVERGGWGRRQRRHHL-- 247

  Fly   799 SKLRGNSSDYLSTNPNRPFLVLHTESSRTRRVRRRAVDCGGALNGQCCKESFYVSFKALGWDDWI 863
                          |:|        |...|||:                  |.|.|..:||..||
Mouse   248 --------------PDR--------SQLCRRVK------------------FQVDFNLIGWGSWI 272

  Fly   864 IAPRGYFANYCRGDCTGSFRTPDTFQ-TFHAHFIEEYRKMGLMNGMRP------CCAPIKFSSMS 921
            |.|:.|.|..|.|:|...  ..:.|. |.||:.      ..|:...:|      ||||:|...:|
Mouse   273 IYPKQYNAYRCEGECPNP--VGEEFHPTNHAYI------QSLLKRYQPHRVPSTCCAPVKTKPLS 329

  Fly   922 LIYYGDDGIIKRDLPKMVVDECGC 945
            ::|..:..::......|:|:||||
Mouse   330 MLYVDNGRVLLEHHKDMIVEECGC 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ActbetaNP_651942.2 TGFb_propeptide 370..>509 CDD:279078
TGF_beta 843..945 CDD:278448 31/108 (29%)
NodalNP_038639.2 TGFb_propeptide 33..169 CDD:279078 8/28 (29%)
TGFB 254..353 CDD:214556 34/124 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.