DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actbeta and daf-7

DIOPT Version :9

Sequence 1:NP_651942.2 Gene:Actbeta / 43826 FlyBaseID:FBgn0024913 Length:946 Species:Drosophila melanogaster
Sequence 2:NP_497265.1 Gene:daf-7 / 175237 WormBaseID:WBGene00000903 Length:350 Species:Caenorhabditis elegans


Alignment Length:343 Identity:80/343 - (23%)
Similarity:132/343 - (38%) Gaps:81/343 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   652 TQYRQYRILEFSAQNRRVPSQKLSIRSAQIHIRIDKPH--SLWIEKAKSLPEK---------HLL 705
            |:|.:..||:           :|:::.|...::...|.  |:::|..:.|.||         ...
 Worm    39 TEYLKNEILD-----------QLNMKEAPKGLKPMDPEMKSVYLEMYRDLLEKDEQDMGVEMSFY 92

  Fly   706 NTK------------RKWGANKPHHRIKIWVFQLSTSINITEKGIDKAIIFRASFQVDPKN---- 754
            ..|            .|:.......|..|....|:.||.|..|  |..::.....||..||    
 Worm    93 TAKDPSYGENPSQLVAKFDVTNDLERSDILQATLTVSIEIPAK--DSGMLQDVQVQVYEKNEDGS 155

  Fly   755 ------------LGWQKFDL---TDTIREWYGHTSHEKL--RLLIDCTGCGGRYSLHLFQTSKLR 802
                        .|.::..:   .||::.|:..:..:.:  :.::|    |...:||..||:...
 Worm   156 MGEMVTSGIFATKGSERISIQLPIDTVKSWFTISPIQGIFVKAMLD----GRNVALHPQQTTADV 216

  Fly   803 GNSSDYLSTNPNRPFLVLHTESSRTRRVRRRAVDCGGALNGQCCKESFYVSFKALGWDDWIIAPR 867
            .|....|||.|         :.||.||...:.|....|.:..||.....:.|:.:|| |||:||.
 Worm   217 DNMRLQLSTRP---------KGSRKRRSHAKPVCNAEAQSKGCCLYDLEIEFEKIGW-DWIVAPP 271

  Fly   868 GYFANYCRGDCTGSFRTPDTFQTFHAHFIEEYRKMGLMNGMRP----CCAPIKFSSMSLIYYGDD 928
            .|.|..|||||..:....:..:|.|:..:....|:.     .|    ||.|.::..:.|||...|
 Worm   272 RYNAYMCRGDCHYNAHHFNLAETGHSKIMRAAHKVS-----NPEIGYCCHPTEYDYIKLIYVNRD 331

  Fly   929 GIIK-RDLPKMVVDECGC 945
            |.:. .::..|:..:|||
 Worm   332 GRVSIANVNGMIAKKCGC 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ActbetaNP_651942.2 TGFb_propeptide 370..>509 CDD:279078
TGF_beta 843..945 CDD:278448 31/106 (29%)
daf-7NP_497265.1 TGFB 250..350 CDD:214556 33/106 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.