DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actbeta and Inhbc

DIOPT Version :9

Sequence 1:NP_651942.2 Gene:Actbeta / 43826 FlyBaseID:FBgn0024913 Length:946 Species:Drosophila melanogaster
Sequence 2:NP_034695.1 Gene:Inhbc / 16325 MGIID:105932 Length:352 Species:Mus musculus


Alignment Length:325 Identity:84/325 - (25%)
Similarity:129/325 - (39%) Gaps:69/325 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   628 DHENIDHEDFFGNTQEIITFAEEGTQYRQYRILEFSAQNRRVPSQKLSIRSAQIHIRIDKPHSLW 692
            :|:....|      .|||:||:..........|||....|.  :..:.:|..:....:..||:  
Mouse    89 EHDQRQEE------YEIISFADTDLSSINQTRLEFHFSGRM--ASGMEVRQTRFMFFVQFPHN-- 143

  Fly   693 IEKAKSLPEKHLLNTKRKWGANKPHHRIKIWVFQ-LSTSINITEKGIDKAIIFRASFQVDPKNLG 756
                    ....:|             |::.|.: ..|::.:|           :.:.|.....|
Mouse   144 --------ATQTMN-------------IRVLVLRPYDTNLTLT-----------SQYVVQVNASG 176

  Fly   757 WQKFDLTDTIREWYGHTSHEKLRLLIDCTGCG-GRYSLHLFQTSKLRGNSSDYLSTNPNRPFLVL 820
            |.:..|....:                 ..|. |..:|.|...|:: .:||..|....:|||:..
Mouse   177 WYQLLLGPEAQ-----------------AACSQGHLTLELVPESQV-AHSSLILGWFSHRPFVAA 223

  Fly   821 HTESSRTRRVRRRAVDCGGALNGQCCKESFYVSFKALGWDDWIIAPRGYFANYCRGDC----TGS 881
            ........|||||.:||.|| :..||::.|:|.|:.:||:||||.|.||..|:|.|.|    .|.
Mouse   224 QVRVEGKHRVRRRGIDCQGA-SRMCCRQEFFVDFREIGWNDWIIQPEGYAMNFCTGQCPLHVAGM 287

  Fly   882 FRTPDTFQTFHAHFIEEYRKMGLMNGMRPCCAPIKFSSMSLIYYG-DDGIIKRDLPKMVVDECGC 945
            .....:|.|...:.::.....| ..|...||.|.....:||:||. |..|:|.|:|.|||:.|||
Mouse   288 PGISASFHTAVLNLLKANAAAG-TTGRGSCCVPTSRRPLSLLYYDRDSNIVKTDIPDMVVEACGC 351

  Fly   946  945
            Mouse   352  351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ActbetaNP_651942.2 TGFb_propeptide 370..>509 CDD:279078
TGF_beta 843..945 CDD:278448 39/106 (37%)
InhbcNP_034695.1 TGFB 247..352 CDD:214556 41/106 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 118 1.000 Domainoid score I5825
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1385831at2759
OrthoFinder 1 1.000 - - FOG0000887
OrthoInspector 1 1.000 - - otm42993
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11848
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X477
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.920

Return to query results.
Submit another query.