DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actbeta and Gdf9

DIOPT Version :9

Sequence 1:NP_651942.2 Gene:Actbeta / 43826 FlyBaseID:FBgn0024913 Length:946 Species:Drosophila melanogaster
Sequence 2:NP_032136.2 Gene:Gdf9 / 14566 MGIID:95692 Length:441 Species:Mus musculus


Alignment Length:371 Identity:83/371 - (22%)
Similarity:141/371 - (38%) Gaps:94/371 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   641 TQEIITFAEEGTQYRQYRILEFSAQNRRVPSQKLS--IRSAQIHIRIDKPHSLWIEKAKSLPEKH 703
            |:|.:........|...|:....||..:.||.:::  :....:...:|:..::          :|
Mouse    98 TKEGVPKPSRSHLYNTVRLFSPCAQQEQAPSNQVTGPLPMVDLLFNLDRVTAM----------EH 152

  Fly   704 LLNTKRKWGANKPHHRIKIWVFQLSTSINIT---EKGIDKAIIF-----RASFQVDPKNLGWQKF 760
            ||.:...:..|.          ..|:|..:|   :..:.:|:..     ||.:....|...|.:.
Mouse   153 LLKSVLLYTLNN----------SASSSSTVTCMCDLVVKEAMSSGRAPPRAPYSFTLKKHRWIEI 207

  Fly   761 DLTDTIREWYGHTSHEK-LRLLIDCTGC-------GGRYS----------LHLFQTSKLRGNSSD 807
            |:|..::...  ||.|: :.|.::.| |       .|.:|          |:|..||....:|..
Mouse   208 DVTSLLQPLV--TSSERSIHLSVNFT-CTKDQVPEDGVFSMPLSVPPSLILYLNDTSTQAYHSWQ 269

  Fly   808 YLST------NPN------RPFL--VLHTESSRTRRVRRRAV--DCGGAL--------------- 841
            .|.:      :|.      ||..  .:..|.|..||..::|:  :..|.|               
Mouse   270 SLQSTWRPLQHPGQAGVAARPVKEEAIEVERSPRRRRGQKAIRSEAKGPLLTASFNLSEYFKQFL 334

  Fly   842 --NGQCCKESFYVSFKALGWDDWIIAPRGYFANYCRGDCTGSFR----TPDTFQTFHAHFIEEYR 900
              ..:|....|.:||..|.||:||:||..|...||:|||..:.|    :|  ..|...:.|  |.
Mouse   335 FPQNECELHDFRLSFSQLKWDNWIVAPHRYNPRYCKGDCPRAVRHRYGSP--VHTMVQNII--YE 395

  Fly   901 KMGLMNGMRPCCAPIKFSSMSLIYYGDDG-IIKRDLPKMVVDECGC 945
            |:. .:..||.|.|.|:|.:|::....|| |..::...|:...|.|
Mouse   396 KLD-PSVPRPSCVPGKYSPLSVLTIEPDGSIAYKEYEDMIATRCTC 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ActbetaNP_651942.2 TGFb_propeptide 370..>509 CDD:279078
TGF_beta 843..945 CDD:278448 35/106 (33%)
Gdf9NP_032136.2 TGF_beta_GDF9 336..441 CDD:381673 36/110 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.