DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actbeta and Gdf5

DIOPT Version :9

Sequence 1:NP_651942.2 Gene:Actbeta / 43826 FlyBaseID:FBgn0024913 Length:946 Species:Drosophila melanogaster
Sequence 2:NP_032135.2 Gene:Gdf5 / 14563 MGIID:95688 Length:495 Species:Mus musculus


Alignment Length:619 Identity:130/619 - (21%)
Similarity:197/619 - (31%) Gaps:194/619 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   394 LPK---QFIW-------ETIYRV----DGGRMIPNNAFGSSGKNLDQKTIKLRAFASPGSHLF-- 442
            |||   ..:|       |.|..|    |.|:..|....|.:.....::....|....||.|::  
Mouse     3 LPKLLTLLLWHLAWLDLELICTVLGAPDLGQRTPGAKPGLTKAEAKERPPLARNVFRPGGHIYGV 67

  Fly   443 -------NGRGGRTDQRSERDPSHHKYRS--------PFDFTFNISKNNVYGKVLRNRSLERIDK 492
                   .|..|:| |..:.:|.....||        |...|             |..:...:..
Mouse    68 GATNARAKGSSGQT-QAKKDEPRKMPPRSGGPETKPGPSSQT-------------RQAAARTVTP 118

  Fly   493 KNSFLNGWTENRQLKINSQIASMPIEL---KSHHNSSPKELKSGAVRKVNGINGTQMNENALKKS 554
            |.....|       |.:|:..|.|...   |:....:|:|.|.            ......:...
Mouse   119 KGQLPGG-------KASSKAGSAPSSFLLKKTREPGTPREPKE------------PFRPPPITPH 164

  Fly   555 TYPIDINHSIDNKTHTGKNGEMS-----HNDYEYFNDYSVQTHDKNRYHEGRSSIGYQPAIHNIE 614
            .|.:.:..::.:....|.|..:.     .|....|.|            :|:...|  ||:....
Mouse   165 EYMLSLYRTLSDADRKGGNSSVKLEAGLANTITSFID------------KGQDDRG--PAVRKQR 215

  Fly   615 YENQKGHHESFADDHENIDHEDFFGNTQEIITFAEEGTQYRQYRILEFSAQNRRVPSQKLSIRSA 679
            |                         ..:|....::|....:.|||.....:...|:...|.|.|
Mouse   216 Y-------------------------VFDISALEKDGLLGAELRILRKKPLDVAKPAVPSSGRVA 255

  Fly   680 QIHIRIDKPHSLWIEKAKSLPEKH----LLNTKRKWGANKPHHRI-KIWVF--------QLSTSI 731
            |:             |..|.|...    ||:.:...|.:.....: .||..        ||...:
Mouse   256 QL-------------KLSSCPSGRQPAALLDVRSVPGLDGSGWEVFDIWKLFRNFKNSAQLCLEL 307

  Fly   732 NITEKGIDKAIIFRASFQVDPKNLGWQKFDLTDTIREWYGHTSHEKLRLLIDCTGCGGRYSLH-- 794
            ...|:|       ||   ||.:.||:::     |.|:     .|||...|:     .||....  
Mouse   308 EAWERG-------RA---VDLRGLGFER-----TARQ-----VHEKALFLV-----FGRTKKRDL 347

  Fly   795 LFQTSKLRGNSSD---YLSTNPNRPFLVLHTESSRTRRVRRRAVDCGGALNGQCCKESFYVSFKA 856
            .|...|.|....|   |       .:|.......|.....|:.......|..:|.:::.:|:||.
Mouse   348 FFNEIKARSGQDDKTVY-------EYLFSQRRKRRAPLANRQGKRPSKNLKARCSRKALHVNFKD 405

  Fly   857 LGWDDWIIAPRGYFANYCRGDCTGSFRT---PDTFQTFHAHFIEEYRKMGLMNGMRP------CC 912
            :|||||||||..|.|.:|.|.|....|:   |    |.||..      ..|||.|.|      ||
Mouse   406 MGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEP----TNHAVI------QTLMNSMDPESTPPTCC 460

  Fly   913 APIKFSSMSLIYYGD-DGIIKRDLPKMVVDECGC 945
            .|.:.|.:|:::... :.::.:....|||:.|||
Mouse   461 VPTRLSPISILFIDSANNVVYKQYEDMVVESCGC 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ActbetaNP_651942.2 TGFb_propeptide 370..>509 CDD:279078 28/145 (19%)
TGF_beta 843..945 CDD:278448 37/111 (33%)
Gdf5NP_032135.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 30..162 28/164 (17%)
TGFb_propeptide 139..338 CDD:279078 48/282 (17%)
TGFB 394..495 CDD:214556 39/111 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.