DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actbeta and Gdf11

DIOPT Version :9

Sequence 1:NP_651942.2 Gene:Actbeta / 43826 FlyBaseID:FBgn0024913 Length:946 Species:Drosophila melanogaster
Sequence 2:NP_034402.1 Gene:Gdf11 / 14561 MGIID:1338027 Length:405 Species:Mus musculus


Alignment Length:336 Identity:81/336 - (24%)
Similarity:136/336 - (40%) Gaps:81/336 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   632 IDHEDFFGNTQEIITFAEEGTQYRQYRILEFSAQNRRVP-------SQKL---SIRSAQ--IHIR 684
            ::.:::...|:.:|:.|:|         .:.:.|....|       |.|:   .:..||  :::|
Mouse   128 LEEDEYHATTETVISMAQE---------TDPAVQTDGSPLCCHFHFSPKVMFTKVLKAQLWVYLR 183

  Fly   685 -IDKPHSLWIE--KAKSLPEKHLLNTKRKWGANKPHHRIKIWVFQLSTSINITEKGIDKAIIFRA 746
             :.:|.:::::  :.|.|..:   .|....|..:.|.||:        |:.|             
Mouse   184 PVPRPATVYLQILRLKPLTGE---GTAGGGGGGRRHIRIR--------SLKI------------- 224

  Fly   747 SFQVDPKNLGWQKFDLTDTIREWYGHTSHEKLRLLIDCTGCGGRYSLHLFQTSKLRGNSSDYLST 811
              ::..::..||..|....:..|:....          :..|  ..::.|..|   |......|.
Mouse   225 --ELHSRSGHWQSIDFKQVLHSWFRQPQ----------SNWG--IEINAFDPS---GTDLAVTSL 272

  Fly   812 NPN----RPFLVLHTESSRTRRVRRRAVDCG-GALNGQCCKESFYVSFKALGWDDWIIAPRGYFA 871
            .|.    .||:.|....:..|..|...:||. .:...:||:....|.|:|.|| ||||||:.|.|
Mouse   273 GPGAEGLHPFMELRVLENTKRSRRNLGLDCDEHSSESRCCRYPLTVDFEAFGW-DWIIAPKRYKA 336

  Fly   872 NYCRGDCTGSFRTPDTFQTF-HAHFIEEYRKMGLMNGMRPCCAPIKFSSMSLIYYGD-DGIIKRD 934
            |||.|.|...|     .|.: |.|.:::....|   ...|||.|.|.|.::::|:.| ..||...
Mouse   337 NYCSGQCEYMF-----MQKYPHTHLVQQANPRG---SAGPCCTPTKMSPINMLYFNDKQQIIYGK 393

  Fly   935 LPKMVVDECGC 945
            :|.||||.|||
Mouse   394 IPGMVVDRCGC 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ActbetaNP_651942.2 TGFb_propeptide 370..>509 CDD:279078
TGF_beta 843..945 CDD:278448 41/103 (40%)
Gdf11NP_034402.1 TGFb_propeptide 59..283 CDD:279078 32/204 (16%)
TGFB 311..405 CDD:214556 43/103 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.