DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actbeta and admp

DIOPT Version :9

Sequence 1:NP_651942.2 Gene:Actbeta / 43826 FlyBaseID:FBgn0024913 Length:946 Species:Drosophila melanogaster
Sequence 2:NP_571951.2 Gene:admp / 140619 ZFINID:ZDB-GENE-011214-1 Length:391 Species:Danio rerio


Alignment Length:307 Identity:82/307 - (26%)
Similarity:129/307 - (42%) Gaps:62/307 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   686 DKPHSLWIE-------KAKS----LPEKHLLNTKRKWG--ANKPHHRIKIWVFQLSTSINITEKG 737
            ||.||..||       .|||    ..|.||...:.|..  .|: ||..::.|:|:   ::.::|.
Zfish    99 DKLHSERIEYLFNMSTVAKSEKILTAELHLFKLRPKTSIVLNR-HHFCQVSVYQV---LDSSKKN 159

  Fly   738 IDKAIIFRASFQVDPKNLGWQKFDLTDTIREWYGHTSHEKLRLLIDC-TGCGGRYSLHLFQTSKL 801
            :.:.....:|..|...:.||:.|.:|..:|.|..... ..|.||:.. |..|.:..|.:.:.:..
Zfish   160 VSQGKKLLSSRLVPIHSTGWEVFTITQAVRSWMSDEG-SNLGLLVSVRTLAGSQMDLKMVRFASG 223

  Fly   802 RGNSSDYLSTNPNRPFLVLHTESSR---------------------------TRRVRRRAVDCGG 839
            |.:.      :..:|.|||.|:..|                           ..|...|:||...
Zfish   224 RDHH------HSKQPMLVLFTDDGRRAASLEATSKGSDVSPGGSSQPLPSVPASRRSSRSVDYDE 282

  Fly   840 ALNGQ---CCKESFYVSFKALGWDDWIIAPRGYFANYCRGDCTGSFRTPDTFQ-TFHAHFIEEYR 900
              .|:   |.::..||.|:.:||..||::|:||.|.:|:|.|.  |......: |.||.......
Zfish   283 --RGEKMACQRQPLYVDFEEIGWSGWIVSPKGYNAYHCKGSCI--FPLSQNMRPTNHAIVQSIIN 343

  Fly   901 KMGLMNGMR-PCCAPIKFSSMSLIYYGDD-GIIKRDLPKMVVDECGC 945
            .:.|..|:: |||.|.|..|:||:|:.|| .::.:....||...|||
Zfish   344 TLKLNKGIQTPCCVPDKLYSISLLYFDDDENVVLKQYDDMVAGSCGC 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ActbetaNP_651942.2 TGFb_propeptide 370..>509 CDD:279078
TGF_beta 843..945 CDD:278448 36/107 (34%)
admpNP_571951.2 TGFb_propeptide 40..237 CDD:279078 37/148 (25%)
TGFB 289..391 CDD:214556 37/104 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.