DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actbeta and Lefty1

DIOPT Version :9

Sequence 1:NP_651942.2 Gene:Actbeta / 43826 FlyBaseID:FBgn0024913 Length:946 Species:Drosophila melanogaster
Sequence 2:NP_034224.1 Gene:Lefty1 / 13590 MGIID:107405 Length:368 Species:Mus musculus


Alignment Length:337 Identity:73/337 - (21%)
Similarity:121/337 - (35%) Gaps:87/337 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   637 FFGNTQEI---ITFAEEGTQYRQYRILEFSAQNRRVPSQKLSIRSAQIHIRIDKPHSLWIEKAKS 698
            |..|.:|:   ...:|..|     .:|.|..:.|..|:.:|    .|..:|:.:         :.
Mouse    78 FSQNLREVAGRFLVSETST-----HLLVFGMEQRLPPNSEL----VQAVLRLFQ---------EP 124

  Fly   699 LPEKHLLNTKRKWGANKPHH---RIKI-WVFQLSTSINITEKGIDKAIIFRASFQVDPKNLGWQK 759
            :|...|...||.    .||.   |:.| |       :...:.|.::..:..:.. |.....||:.
Mouse   125 VPRTALRRQKRL----SPHSARARVTIEW-------LRFRDDGSNRTALIDSRL-VSIHESGWKA 177

  Fly   760 FDLTDTIREWYGHTSHEKLRLLIDCT------GCGGRYSLHLFQTSKLRGNSSDYLSTNPNRPFL 818
            ||:|:.:..|. ..|..:..||:..:      | .|.:|.|.......:|...   ......|.|
Mouse   178 FDVTEAVNFWQ-QLSRPRQPLLLQVSVQREHLG-PGTWSSHKLVRFAAQGTPD---GKGQGEPQL 237

  Fly   819 VLHTESSRTRRVRRRAVDCGGALN----------GQCCKESFYVSFKALGW-DDWIIAPRGYFAN 872
            .|||...:         |.|...|          .:||::..|:..:.:.| ::||:.|.|:...
Mouse   238 ELHTLDLK---------DYGAQGNCDPEAPVTEGTRCCRQEMYLDLQGMKWAENWILEPPGFLTY 293

  Fly   873 YCRGDCTGSFRTPDTFQTFHAHFIEEYRKMGLMNGMRPCCAPIKFSSMSLIYYGDDGIIKR---- 933
            .|.|.|   .:.|::. |....|:          |.|.|.|. :.:|:.:|....:|...|    
Mouse   294 ECVGSC---LQLPESL-TSRWPFL----------GPRQCVAS-EMTSLPMIVSVKEGGRTRPQVV 343

  Fly   934 DLPKMVVDECGC 945
            .||.|.|..|.|
Mouse   344 SLPNMRVQTCSC 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ActbetaNP_651942.2 TGFb_propeptide 370..>509 CDD:279078
TGF_beta 843..945 CDD:278448 27/106 (25%)
Lefty1NP_034224.1 TGFb_propeptide <106..211 CDD:279078 26/131 (20%)
TGF_beta 263..355 CDD:278448 27/106 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11848
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.