DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actbeta and Bmp8a

DIOPT Version :9

Sequence 1:NP_651942.2 Gene:Actbeta / 43826 FlyBaseID:FBgn0024913 Length:946 Species:Drosophila melanogaster
Sequence 2:NP_001242948.1 Gene:Bmp8a / 12163 MGIID:104515 Length:412 Species:Mus musculus


Alignment Length:387 Identity:86/387 - (22%)
Similarity:142/387 - (36%) Gaps:118/387 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   622 HESFADDHENIDHEDFFGNTQEIITFA-----EEGTQYRQYRILEFSAQNRRVPSQKLSIRSAQI 681
            :.:..||.:....:...|....:::|.     :....|::....||.....::|:.: ::.:|:.
Mouse    80 YHAMTDDDDGGPPQAHLGRADLVMSFVNMVERDRTLGYQEPHWKEFHFDLTQIPAGE-AVTAAEF 143

  Fly   682 HIRIDKPHSLWIEKAKSLPEKHLLNTKRKWGANKPHHRIKIWVFQLSTSINITEKGIDKAIIFRA 746
            .|..:             |..|.|||           .:.|.:|::....:..|..:        
Mouse   144 RIYKE-------------PSTHPLNT-----------TLHISMFEVVQEHSNRESDL-------- 176

  Fly   747 SFQVDPKNL-----GWQKFDLTDTIREWYGHTSHEK---LRLLIDCTGCGGRYSLHLFQTSKLRG 803
             |.:|.:.|     ||...|:|.....|.  .:|.|   |||.::...                |
Mouse   177 -FFLDLQTLRSGDEGWLVLDITAASDRWL--LNHHKDLGLRLYVETAD----------------G 222

  Fly   804 NSSD--------YLSTNPNRPFLVLHTESSRT--------RRVRRR----------------AVD 836
            :|.|        ..:....:||:|....:|::        |.::||                ..|
Mouse   223 HSMDPGLAGLLGRQAPRSRQPFMVTFFRASQSPVRAPRAARPLKRRQPKKTNELPHPNKLPGIFD 287

  Fly   837 CGGALNGQ--CCKESFYVSFKALGWDDWIIAPRGYFANYCRGDCTGSFRTPDTFQTFHAHFI--- 896
            .|....|:  |.:...||||:.|||.||:|||:||.|.||.|:|....   |:......|.|   
Mouse   288 DGHGSRGREVCRRHELYVSFRDLGWLDWVIAPQGYSAYYCEGECAFPL---DSCMNATNHAILQS 349

  Fly   897 ---------EEYRKMGLMNG---MRPCCAPIKFSSMSLIYY-GDDGIIKRDLPKMVVDECGC 945
                     :.:..:.||..   .:.||||.|.|:.|::|| ..:.:|.|....|||..|||
Mouse   350 LVSTTVACCDRWSGVHLMKPDVVPKACCAPTKLSATSVLYYDSSNNVILRKHRNMVVKACGC 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ActbetaNP_651942.2 TGFb_propeptide 370..>509 CDD:279078
TGF_beta 843..945 CDD:278448 41/119 (34%)
Bmp8aNP_001242948.1 TGFb_propeptide 32..248 CDD:279078 37/219 (17%)
TGF_beta 298..411 CDD:278448 40/115 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.