DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actbeta and Bmp6

DIOPT Version :9

Sequence 1:NP_651942.2 Gene:Actbeta / 43826 FlyBaseID:FBgn0024913 Length:946 Species:Drosophila melanogaster
Sequence 2:NP_031582.1 Gene:Bmp6 / 12161 MGIID:88182 Length:510 Species:Mus musculus


Alignment Length:635 Identity:132/635 - (20%)
Similarity:207/635 - (32%) Gaps:264/635 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   374 IKRQILTKLGLSHKPNVSHPL---------PKQFIWETIYRVDGGRMIPNNAFGSSGKNLDQKTI 429
            ::::||:.|||.|:|...|.|         |:|                      ..:...|:| 
Mouse    76 MQKEILSVLGLPHRPRPLHGLQQPQPPVLPPQQ----------------------QQQQQQQQT- 117

  Fly   430 KLRAFASPGSHLFNGRGGRTDQRSERDPSHHKYRSPFDFTFNISKNNVYGKVLRNRSLERIDKKN 494
                                 .|.|..|..                      |::..|..:|..|
Mouse   118 ---------------------AREEPPPGR----------------------LKSAPLFMLDLYN 139

  Fly   495 SFLNGWTENRQLKINSQIASMPIELKSHHNSSPKELKS---GAVRKVNGINGTQMNENALKKSTY 556
            :..|...|:...:...|      |..||..:|..:|:.   ||.                     
Mouse   140 ALSNDDEEDGASEGVGQ------EPGSHGGASSSQLRQPSPGAA--------------------- 177

  Fly   557 PIDINHSIDNKT------HTGKNGEMSHNDYEYFNDYSVQTHDKNRYHEGRSSIGYQPAIHNIEY 615
                 ||::.|:      ..|.:...|..|..:.||..:                ....::.:||
Mouse   178 -----HSLNRKSLLAPGPGGGASPLTSAQDSAFLNDADM----------------VMSFVNLVEY 221

  Fly   616 ENQKGHHESFADDHENIDHEDFFGNTQEI-----ITFAEEGTQYRQYR---ILEFSAQNRRVPSQ 672
            :.:...|:.        .|::|..|..:|     :|.||    :|.|:   :..|..|...:...
Mouse   222 DKEFSPHQR--------HHKEFKFNLSQIPEGEAVTAAE----FRVYKDCVVGSFKNQTFLISIY 274

  Fly   673 KLSIRSAQIHIRIDKPHSLWIEKAKSLPEKHLLNTKRKWGANKPHHRIKIWVFQLSTSINITEKG 737
            ::    .|.|...|.             :..||:|:..|.:.:                      
Mouse   275 QV----LQEHQHRDS-------------DLFLLDTRVVWASEE---------------------- 300

  Fly   738 IDKAIIFRASFQVDPKNLGWQKFDLTDTIREWYGHTSHEK-LRLLIDCTGCGGRYSLHLF-QTSK 800
                              ||.:||:|.|...|.....|.. |:|.:..     |..||:. :.:.
Mouse   301 ------------------GWLEFDITATSNLWVVTPQHNMGLQLSVVT-----RDGLHVNPRAAG 342

  Fly   801 LRGNSSDYLSTNPNRPFLV-------LHTESSRTRRVRRR------------------AVDCGGA 840
            |.|....|    ..:||:|       :|..::|:...|||                  :.|..|:
Mouse   343 LVGRDGPY----DKQPFMVAFFKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVSRGSGSSDYNGS 403

  Fly   841 -LNGQCCKESFYVSFKALGWDDWIIAPRGYFANYCRGDCTGSFRTPDTFQTFHAHFIEEYRK--- 901
             |...|.|...||||:.|||.||||||:||.||||.|:|  ||       ..:||.......   
Mouse   404 ELKTACKKHELYVSFQDLGWQDWIIAPKGYAANYCDGEC--SF-------PLNAHMNATNHAIVQ 459

  Fly   902 --MGLMNG---MRPCCAPIKFSSMSLIYYGDD-GIIKRDLPKMVVDECGC 945
              :.|||.   .:|||||.|.:::|::|:.|: .:|.:....|||..|||
Mouse   460 TLVHLMNPEYVPKPCCAPTKLNAISVLYFDDNSNVILKKYRNMVVRACGC 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ActbetaNP_651942.2 TGFb_propeptide 370..>509 CDD:279078 22/143 (15%)
TGF_beta 843..945 CDD:278448 44/110 (40%)
Bmp6NP_031582.1 TGFb_propeptide 58..359 CDD:279078 78/474 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 87..129 12/107 (11%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 143..199 14/87 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 370..402 5/31 (16%)
TGFB 409..510 CDD:214556 46/110 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.