DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actbeta and Amh

DIOPT Version :10

Sequence 1:NP_651942.2 Gene:Actbeta / 43826 FlyBaseID:FBgn0024913 Length:946 Species:Drosophila melanogaster
Sequence 2:NP_031471.2 Gene:Amh / 11705 MGIID:88006 Length:554 Species:Mus musculus


Alignment Length:148 Identity:41/148 - (27%)
Similarity:57/148 - (38%) Gaps:21/148 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   810 STNPNRPFLVL----------HTESSRTRRVRRRAVDCGGALNGQCCKESFYVSFKALGWDDWII 864
            |.:|.|..|:|          |....|.|..|    ..|...:|.|......|..:|   :..::
Mouse   415 SGDPLRALLLLKALQGLRAEWHGREGRGRTGR----SAGTGTDGPCALRELSVDLRA---ERSVL 472

  Fly   865 APRGYFANYCRGDCT--GSFRTPDTFQTFHAHFIEEYRKMGLMNGMRPCCAPIKFSSMSLIYYGD 927
            .|..|.||.|:|.|.  .|.|.|....  |...:.:.:..|...|..|||.|..::...||...:
Mouse   473 IPETYQANNCQGACAWPQSDRNPRYGN--HVVLLLKMQARGAALGRLPCCVPTAYAGKLLISLSE 535

  Fly   928 DGIIKRDLPKMVVDECGC 945
            :.|....:|.||..||||
Mouse   536 ERISAHHVPNMVATECGC 553

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ActbetaNP_651942.2 TGF_beta_INHB 845..945 CDD:381630 28/101 (28%)
AmhNP_031471.2 AMH_N 76..396 CDD:461402
TGF_beta_AMH 455..554 CDD:381635 30/104 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.