DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actbeta and inhbc.2

DIOPT Version :9

Sequence 1:NP_651942.2 Gene:Actbeta / 43826 FlyBaseID:FBgn0024913 Length:946 Species:Drosophila melanogaster
Sequence 2:XP_002939474.1 Gene:inhbc.2 / 100494560 XenbaseID:XB-GENE-1217521 Length:354 Species:Xenopus tropicalis


Alignment Length:328 Identity:84/328 - (25%)
Similarity:132/328 - (40%) Gaps:75/328 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   635 EDFFGNTQEIITFAEEGTQYRQYRILEFSAQNRRVPSQKLSIRSAQIHIRIDKPHSLWIEKAKSL 699
            ||...:.::    |||....:.|.::.|:    .:.|.:.|......|:..:|            
 Frog    84 EDLLSSREQ----AEELDSDQDYEVISFA----DIESSQASQTILHFHLSAEK------------ 128

  Fly   700 PEKHLLNTKRKWGANKPHHRIKIWVF-----------QLSTSINITEKGIDKAI---IFRASFQV 750
                        |..:..|...:|::           |::||: ..||...:.|   |.|:    
 Frog   129 ------------GTYREIHNAALWLYLQSDPSKKLAIQITTSL-AKEKSSTEMIHREIVRS---- 176

  Fly   751 DPKNLGWQKFDLTDTIREWYGHTSHEKLRLLIDCTGCGGRYSLHLFQTSKLRGNSSDYLSTNPNR 815
                 ||....|....:...| ...|.:.|.::|..|.|:..:.         |.||     ..|
 Frog   177 -----GWYTLPLPMLTQAALG-DGEENIYLYLECLNCTGQPVIR---------NISD-----AQR 221

  Fly   816 PFLVLHTESSR-TRRVRRRAVDCGGALNGQCCKESFYVSFKALGWDDWIIAPRGYFANYCRGDCT 879
            ||||:...:.| ..|.||...:|...:: .||:::||:.||.:||.||||:|.||..|||.|.|.
 Frog   222 PFLVVKAHNQREDHRFRRHITECSSDVD-MCCRKNFYIDFKEIGWTDWIISPEGYNMNYCEGRCP 285

  Fly   880 GSF-RTPDTFQTFHAHFIEEYRKMGLMNGMRPCCAPIKFSSMSLIYYG-DDGIIKRDLPKMVVDE 942
            ... |.|....:.|...:...:...|......||.|.|...:||:|:. .:.|:|.|:|.|:|:.
 Frog   286 VHLARVPGIAASSHTAILSLIKANNLYASFSSCCVPTKRRPLSLLYFDMYNSIVKTDIPDMIVES 350

  Fly   943 CGC 945
            |||
 Frog   351 CGC 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ActbetaNP_651942.2 TGFb_propeptide 370..>509 CDD:279078
TGF_beta 843..945 CDD:278448 38/103 (37%)
inhbc.2XP_002939474.1 TGFb_propeptide 50..226 CDD:366248 38/198 (19%)
TGF_beta_SF 251..354 CDD:394804 40/103 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 118 1.000 Domainoid score I5766
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 190 1.000 Inparanoid score I3759
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1385831at2759
OrthoFinder 1 1.000 - - FOG0000887
OrthoInspector 1 1.000 - - otm48117
Panther 1 1.100 - - O PTHR11848
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X477
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.070

Return to query results.
Submit another query.