DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actbeta and gdf5

DIOPT Version :9

Sequence 1:NP_651942.2 Gene:Actbeta / 43826 FlyBaseID:FBgn0024913 Length:946 Species:Drosophila melanogaster
Sequence 2:XP_002662587.1 Gene:gdf5 / 100334210 ZFINID:ZDB-GENE-990415-39 Length:474 Species:Danio rerio


Alignment Length:362 Identity:89/362 - (24%)
Similarity:144/362 - (39%) Gaps:95/362 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   627 DDHENIDHEDFFGNTQEIITFAEEGTQ------YRQYRILEFSAQNRRVPSQKLSIRSAQIHIRI 685
            |.:.::.||....||  |.:|.:.|..      .||..:...|:.      :|..:..|::.|  
Zfish   164 DVNTSVLHEAGMANT--ITSFVDRGQDERAPLLRRQRYVFNISSM------EKEGLLGAELRI-- 218

  Fly   686 DKPHSLWIEKAKSLPEKHLLNTKRKWGANKPHHRIKIWVFQLSTSINITEKGIDKAIIFRASFQV 750
                         |.:||:.:.|..:...       :.|.:|.|..:    |.:.|::.:|. ..
Zfish   219 -------------LRKKHMDSRKATFSEG-------MAVLRLFTCAS----GKNAAVLLQAR-PF 258

  Fly   751 DPKNLG-WQKFDLTDTIREWYGHTSHEKLRLLIDCTGCGGRYSLHL------------------F 796
            |..:.. |:.||:....:.:   .:..:|.|.:|....|....|.|                  |
Zfish   259 DSHSASYWEVFDIWKVFKNF---RNTPQLCLELDAVDHGRPLDLRLLGLSRAGRQTKEKAFFVVF 320

  Fly   797 QTSKLRG---NSSDYLSTNPNRP-FLVLHTESSRTRRVRRRAVDCGGA----LNGQCCKESFYVS 853
            ..:|.||   |.....|.:.|:. :..|.|:    ||:||..:..|..    ...:|.::..:|:
Zfish   321 GRTKKRGLFYNEIKARSGHDNKTVYEYLFTQ----RRMRRAPLPRGKKPIKNPKQRCNRKQLHVN 381

  Fly   854 FKALGWDDWIIAPRGYFANYCRGDCTGSFRT---PDTFQTFHAHFIEEYRKMGLMNGMRP----- 910
            ||.:|||||||||..|.|.:|.|.|....|:   |    |.|| .|:.     |||.|.|     
Zfish   382 FKEMGWDDWIIAPLEYEAFHCDGVCDFPIRSHLEP----TNHA-IIQT-----LMNSMDPRSTPP 436

  Fly   911 -CCAPIKFSSMSLIYYGD-DGIIKRDLPKMVVDECGC 945
             ||.|.:.|.:|::|... :.::.:....|||:.|||
Zfish   437 TCCVPTRLSPISILYIDSANNVVYKQYEDMVVESCGC 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ActbetaNP_651942.2 TGFb_propeptide 370..>509 CDD:279078
TGF_beta 843..945 CDD:278448 39/111 (35%)
gdf5XP_002662587.1 TGFb_propeptide 138..320 CDD:279078 34/193 (18%)
TGF_beta 371..473 CDD:278448 39/111 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.