DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actbeta and LOC100329520

DIOPT Version :9

Sequence 1:NP_651942.2 Gene:Actbeta / 43826 FlyBaseID:FBgn0024913 Length:946 Species:Drosophila melanogaster
Sequence 2:XP_002662616.2 Gene:LOC100329520 / 100329520 -ID:- Length:368 Species:Danio rerio


Alignment Length:307 Identity:78/307 - (25%)
Similarity:137/307 - (44%) Gaps:67/307 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   657 YRILEFSAQNRRVPSQ---KLSIRSAQIHIRIDKPHSLWIEKAKSLPEKHLLNTKRKWGANKPHH 718
            |.|:.|:..:..:|:.   .||.:..|     :|.||:.:.::                      
Zfish   110 YEIVSFADIDGDLPNSIDTSLSFQFLQ-----EKGHSVQVLQS---------------------- 147

  Fly   719 RIKIWVF-------QLSTSINITEKGIDKAIIFRASFQVDPKNLGWQKFDLTDTIREWYGHTSHE 776
              .:|::       ::|..|.::: ..::.::.:.|  ||....||..|.:|.|::.:. .....
Zfish   148 --SLWLYLRPSESSRISAEIYLSD-STNRTLVLQRS--VDAARGGWHTFPVTSTLQAFL-DGGQR 206

  Fly   777 KLRLLIDCTGCGGRYSLHLFQTSKLRGNSSDYLSTNPNRPFLVLHT---ESSRTRRVRRRAVDCG 838
            :|||.:.|...|    .:|.:......:|        ::||||...   |......:.:|::.||
Zfish   207 RLRLEVQCQDAG----RNLCKKEPTEDSS--------HQPFLVAQVRLREDPSKHALSKRSLRCG 259

  Fly   839 GALNGQCCKESFYVSFKALGWDDWIIAPRGYFANYCRGDC----TGSFRTPDTFQTFHAHFIEEY 899
            ..:. .|||:.||:.|:.:.|.||||||.||..|||.|.|    :||   |....:|||....:.
Zfish   260 DDVT-VCCKKDFYIKFRDIQWQDWIIAPEGYHMNYCMGQCPQHLSGS---PGIASSFHASVFSQL 320

  Fly   900 RKMGLMNGMRPCCAPIKFSSMSLIYYGDD-GIIKRDLPKMVVDECGC 945
            :..|:...:..||.||:...:|::|:... .|:|.|:|.|:|:.|||
Zfish   321 KANGINTAVSSCCVPIQRRPLSMVYFNSQHTIVKTDVPDMIVESCGC 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ActbetaNP_651942.2 TGFb_propeptide 370..>509 CDD:279078
TGF_beta 843..945 CDD:278448 40/106 (38%)
LOC100329520XP_002662616.2 TGFb_propeptide 54..238 CDD:279078 31/172 (18%)
TGF_beta 265..367 CDD:278448 40/104 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 121 1.000 Domainoid score I5640
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 190 1.000 Inparanoid score I3867
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1385831at2759
OrthoFinder 1 1.000 - - FOG0000887
OrthoInspector 1 1.000 - - otm24667
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11848
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X477
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
99.070

Return to query results.
Submit another query.