DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Actbeta and gdf5

DIOPT Version :9

Sequence 1:NP_651942.2 Gene:Actbeta / 43826 FlyBaseID:FBgn0024913 Length:946 Species:Drosophila melanogaster
Sequence 2:NP_001128589.1 Gene:gdf5 / 100189547 XenbaseID:XB-GENE-481784 Length:496 Species:Xenopus tropicalis


Alignment Length:345 Identity:84/345 - (24%)
Similarity:129/345 - (37%) Gaps:82/345 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   639 GNTQEIITFAEEG------TQYRQYRILEFSA--QNRRVPSQKLSIRSAQIHIRIDKPHSLWIEK 695
            |....|.:|.::|      ...||....:.||  ::..:.::...:|...|..:::....||..|
 Frog   195 GLANTITSFIDKGQDERMAAARRQKYTFDISALEKDGLLGAELRILRKRPIDAKLNSAGKLWQIK 259

  Fly   696 AKSLPEKH----LLNTKRKWGANKPHHRI-KIWVF--------QLSTSINITEKGIDKAIIFRAS 747
            ..|.|...    ||:::.....:.|...: .||..        ||...:.:.:||          
 Frog   260 LYSCPANKKSATLLDSRPLGSIDTPKWEVFDIWKLYKNFKNSVQLCFELEVLDKG---------- 314

  Fly   748 FQVDPKNLGWQKFDLTDTIREWYGHTSHEKLRLLIDCTGCGGRYSLH--LFQTSKLRGNSSD--- 807
               .|.:|....|:.|       |..::||...|:     .||....  .|...|.|....|   
 Frog   315 ---KPADLRSVGFNRT-------GRQTNEKAIFLV-----FGRTKKRDLFFNEIKARSGQDDKTV 364

  Fly   808 --YLSTNPNRPFLVLHTESSRTRRVRRRAVDCGGALNGQCCKESFYVSFKALGWDDWIIAPRGYF 870
              ||.....:....|.|...:......:|         :|.|:..:|:||.:|||||||||..|.
 Frog   365 YEYLFNQRRKRRAPLSTRQGKRPNKNSKA---------RCSKKPLHVNFKDMGWDDWIIAPLEYE 420

  Fly   871 ANYCRGDCTGSFRT---PDTFQTFHAHFIEEYRKMGLMNGMRP------CCAPIKFSSMSLIYYG 926
            |.:|.|.|....|:   |    |.||..      ..|||.|.|      ||.|.:.|.:|::|..
 Frog   421 AYHCEGLCEFPLRSHLEP----TNHAVI------QTLMNSMDPETTPPTCCVPTRLSPISILYTD 475

  Fly   927 D-DGIIKRDLPKMVVDECGC 945
            . :.::.:....|||:.|||
 Frog   476 SANNVVYKQYEDMVVESCGC 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ActbetaNP_651942.2 TGFb_propeptide 370..>509 CDD:279078
TGF_beta 843..945 CDD:278448 39/111 (35%)
gdf5NP_001128589.1 TGFb_propeptide 142..328 CDD:279078 28/152 (18%)
TGFB 395..496 CDD:214556 41/111 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.