DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sv and MIXL1

DIOPT Version :10

Sequence 1:NP_524633.3 Gene:sv / 43825 FlyBaseID:FBgn0005561 Length:844 Species:Drosophila melanogaster
Sequence 2:NP_001269331.1 Gene:MIXL1 / 83881 HGNCID:13363 Length:240 Species:Homo sapiens


Alignment Length:30 Identity:12/30 - (40%)
Similarity:19/30 - (63%) Gaps:0/30 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   784 GTGSGLINSSYYYESGQTQSPLTHDLRSPL 813
            |.|.|:.:||...::.:|.|||:.|:.|.|
Human   197 GVGGGISDSSSQGQNFETCSPLSEDIGSKL 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
svNP_524633.3 PAX 175..299 CDD:128645
MIXL1NP_001269331.1 Homeodomain 87..151 CDD:459649
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.