DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sv and RHOXF2B

DIOPT Version :10

Sequence 1:NP_524633.3 Gene:sv / 43825 FlyBaseID:FBgn0005561 Length:844 Species:Drosophila melanogaster
Sequence 2:NP_001093155.1 Gene:RHOXF2B / 727940 HGNCID:33519 Length:288 Species:Homo sapiens


Alignment Length:203 Identity:38/203 - (18%)
Similarity:61/203 - (30%) Gaps:68/203 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   605 ENCSSLVGQEHIVMPESSDSNTLCPISTRIVPDITETNSTRVKEPLTNSDGCSEDNNKEPEKSNS 669
            :.||..:  ..::.|...|...|..::..:: .:||    .|||         |:.:.:||....
Human     5 DQCSQYM--TSLLSPAVDDEKELQDMNAMVL-SLTE----EVKE---------EEEDAQPEPEQG 53

  Fly   670 SQSSDHIASPHLHHIGEEQLRGNRRSNLNASTHPSSLIPLQPSGGSSLLNINPSENRSDVELNLS 734
            :.:.:.:.|..... |||:..|....:...:..|..|                      .|.||.
Human    54 TAAGEKLKSAGAQG-GEEKDGGGEEKDGGGAGVPGHL----------------------WEGNLE 95

  Fly   735 NNVGLYSTPTVLPSFNHYSAGCSSVVPGSDYAYNPAYTQYGGAYGSYGYGTGSGLINSSYYYESG 799
            .                 ::|....|..||.:......||....|:.|     ||       |.|
Human    96 G-----------------TSGSDGNVEDSDQSEKEPGQQYSRPQGAVG-----GL-------EPG 131

  Fly   800 QTQSPLTH 807
            ..|.|..|
Human   132 NAQQPNVH 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
svNP_524633.3 PAX 175..299 CDD:128645
RHOXF2BNP_001093155.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 16..136 34/185 (18%)
Homeodomain 139..191 CDD:459649 1/1 (100%)
PRK02287 <183..>232 CDD:235024
Nuclear localization signal. /evidence=ECO:0000250 186..195
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.