DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sv and SDCBP

DIOPT Version :9

Sequence 1:NP_524633.3 Gene:sv / 43825 FlyBaseID:FBgn0005561 Length:844 Species:Drosophila melanogaster
Sequence 2:NP_001335270.1 Gene:SDCBP / 6386 HGNCID:10662 Length:319 Species:Homo sapiens


Alignment Length:203 Identity:41/203 - (20%)
Similarity:72/203 - (35%) Gaps:29/203 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 VNGRPL-------PDVVRQRIVELAHN--GVRPCDISRQLRVSHGCVSK-----ILSRYYETGSF 237
            |:|.||       |..:...:..:..|  |:|..:|.:.:|....|..:     :..:..:.|.|
Human    94 VSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIF 158

  Fly   238 KAGVIGGSKPKVATPPVVDAIANYKRENPTMFAWEIRDRLLAEAICSQDNVPSVSSINRIVRNKA 302
            ...|...|...:......|.:.....||...::.:...::|.:|...:        |...:|::.
Human   159 VQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEK--------ITMTIRDRP 215

  Fly   303 AEKAKHVHHHQQHHVSQSLGGGHIATESVDSS---TGTIGEPQPPTSNSSANSVNTNVSASASVH 364
            .|:...:|.....||......|.|.:...|||   .|.:.|......|.. |.:....|..|.: 
Human   216 FERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQ-NVIGLKDSQIADI- 278

  Fly   365 ASIPTSGT 372
              :.||||
Human   279 --LSTSGT 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
svNP_524633.3 PAX 175..299 CDD:128645 21/125 (17%)
SDCBPNP_001335270.1 PDZ_signaling 133..212 CDD:238492 12/86 (14%)
PDZ_signaling 217..290 CDD:238492 19/72 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.