Sequence 1: | NP_524633.3 | Gene: | sv / 43825 | FlyBaseID: | FBgn0005561 | Length: | 844 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001335270.1 | Gene: | SDCBP / 6386 | HGNCID: | 10662 | Length: | 319 | Species: | Homo sapiens |
Alignment Length: | 203 | Identity: | 41/203 - (20%) |
---|---|---|---|
Similarity: | 72/203 - (35%) | Gaps: | 29/203 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 187 VNGRPL-------PDVVRQRIVELAHN--GVRPCDISRQLRVSHGCVSK-----ILSRYYETGSF 237
Fly 238 KAGVIGGSKPKVATPPVVDAIANYKRENPTMFAWEIRDRLLAEAICSQDNVPSVSSINRIVRNKA 302
Fly 303 AEKAKHVHHHQQHHVSQSLGGGHIATESVDSS---TGTIGEPQPPTSNSSANSVNTNVSASASVH 364
Fly 365 ASIPTSGT 372 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
sv | NP_524633.3 | PAX | 175..299 | CDD:128645 | 21/125 (17%) |
SDCBP | NP_001335270.1 | PDZ_signaling | 133..212 | CDD:238492 | 12/86 (14%) |
PDZ_signaling | 217..290 | CDD:238492 | 19/72 (26%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0849 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |