DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sv and Sebox

DIOPT Version :10

Sequence 1:NP_524633.3 Gene:sv / 43825 FlyBaseID:FBgn0005561 Length:844 Species:Drosophila melanogaster
Sequence 2:NP_076441.1 Gene:Sebox / 58922 RGDID:62077 Length:188 Species:Rattus norvegicus


Alignment Length:101 Identity:26/101 - (25%)
Similarity:34/101 - (33%) Gaps:24/101 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   517 TPISGSGATASGNDTSMLYDSITTISQTQSSIYTPAIGPSIGTGSLTPLVPISMHEMKLSANSIQ 581
            ||.....:|:|...||        ....|:|...|.:||...........|....|:. ..:|: 
  Rat   106 TPSHPLHSTSSAQQTS--------ACPPQTSCLAPILGPGQSWSGAKAAAPWGTSEVS-GVHSL- 160

  Fly   582 EQTVPPFYTALAFDGNYTSMTSLENCSSLVGQEHIV 617
            ||.||              .|||.|.|.|:....||
  Rat   161 EQIVP--------------QTSLGNLSDLIYTSAIV 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
svNP_524633.3 PAX 175..299 CDD:128645
SeboxNP_076441.1 COG5576 <13..121 CDD:227863 4/14 (29%)
Homeodomain 19..72 CDD:459649
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 80..125 6/26 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.