DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sv and gsc

DIOPT Version :10

Sequence 1:NP_524633.3 Gene:sv / 43825 FlyBaseID:FBgn0005561 Length:844 Species:Drosophila melanogaster
Sequence 2:NP_001016704.1 Gene:gsc / 549458 XenbaseID:XB-GENE-486771 Length:243 Species:Xenopus tropicalis


Alignment Length:137 Identity:34/137 - (24%)
Similarity:45/137 - (32%) Gaps:41/137 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   711 PSGGSSLLNINPSENRSDVELNLSNNVGLYSTPTVLPSFNHYSAGCSSVVPGSDYAYNPAYTQYG 775
            |||..|:.||..:..|....:.|..|     .|.|..|.             .:..|.||  .|.
 Frog     2 PSGMFSIDNILAARPRCKESVLLPQN-----GPMVFSSL-------------GESLYGPA--DYS 46

  Fly   776 GAY-------GSYGYGTGSGLINSSYYYESGQTQSPLTHDLRSPLVATRANSLA---------SA 824
            |.|       .:....|||.|..::|||.....|:|:     .|.......||.         :.
 Frog    47 GFYNRAVAPTSTLQAVTGSRLGFNNYYYGQLHVQTPM-----GPSCCGAVQSLGTQQCSCVPPAT 106

  Fly   825 ASPGSGS 831
            |..|:||
 Frog   107 AYDGAGS 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
svNP_524633.3 PAX 175..299 CDD:128645
gscNP_001016704.1 Homeodomain 149..205 CDD:459649
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.