DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sv and otx2

DIOPT Version :10

Sequence 1:NP_524633.3 Gene:sv / 43825 FlyBaseID:FBgn0005561 Length:844 Species:Drosophila melanogaster
Sequence 2:XP_012823826.1 Gene:otx2 / 548931 XenbaseID:XB-GENE-485220 Length:306 Species:Xenopus tropicalis


Alignment Length:167 Identity:42/167 - (25%)
Similarity:64/167 - (38%) Gaps:47/167 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   692 NRRSNLNASTHPSSLIPLQPSGGSSLLNINPSENRSDVELNLSNNVGL---YSTP--TVLPSFNH 751
            |||:........      |.:||.:  .:.||:.:......:|:..|.   :|.|  |.:|..:.
 Frog   105 NRRAKCRQQQQQ------QQNGGQN--KVRPSKKKPSPAREVSSESGTSGQFSPPCSTSVPVISS 161

  Fly   752 YSAGCS-----SVVPGSD----------YAYNPAYTQYGGAYGSYGYGTGSGLINSSYY--YESG 799
            .:|..|     |:.|.||          .:|...|||..|.  |.|| .||    :||:  .:.|
 Frog   162 STAPVSIWSPASISPLSDPLSTSSSCMQRSYPMTYTQASGY--SQGY-AGS----TSYFGGMDCG 219

  Fly   800 QTQSPLTHDLR------SPL----VATRANSLASAAS 826
            ...:|:.|.|.      ||:    |.:..|...:|.|
 Frog   220 SYLTPMHHQLSGAGATLSPMGTNAVTSHLNQSPAALS 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
svNP_524633.3 PAX 175..299 CDD:128645
otx2XP_012823826.1 Homeodomain 56..111 CDD:459649 3/5 (60%)
TF_Otx 170..251 CDD:427350 24/87 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.