DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sv and Sdcbp

DIOPT Version :9

Sequence 1:NP_524633.3 Gene:sv / 43825 FlyBaseID:FBgn0005561 Length:844 Species:Drosophila melanogaster
Sequence 2:NP_001091697.1 Gene:Sdcbp / 53378 MGIID:1337026 Length:299 Species:Mus musculus


Alignment Length:167 Identity:32/167 - (19%)
Similarity:58/167 - (34%) Gaps:22/167 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 VNGRPL-------PDVVRQRIVELAHN--GVRPCDISRQLRVSHGCVSK-----ILSRYYETGSF 237
            |:|.|.       |..|...:..:..|  |:|..:|.:.:|....|..:     :..:..:.|.|
Mouse    74 VSGAPAQGQLVARPSSVNYMVAPVTGNDAGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIF 138

  Fly   238 KAGVIGGSKPKVATPPVVDAIANYKRENPTMFAWEIRDRLLAEAICSQDNVPSVSSINRIVRNKA 302
            ...|...|...:......|.:.....||...::.:...::|.:|...:        |...:|::.
Mouse   139 VQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEK--------ITMTIRDRP 195

  Fly   303 AEKAKHVHHHQQHHVSQSLGGGHIATESVDSSTGTIG 339
            .|:...:|.....||......|.|.:...|||....|
Mouse   196 FERTVTMHKDSSGHVGFIFKSGKITSIVKDSSAARNG 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
svNP_524633.3 PAX 175..299 CDD:128645 21/125 (17%)
SdcbpNP_001091697.1 Interaction with PDCD6IP. /evidence=ECO:0000269|PubMed:22660413 2..103 6/28 (21%)
LYPX(n)L motif 1. /evidence=ECO:0000305|PubMed:22660413 3..7
LYPX(n)L motif 2. /evidence=ECO:0000305|PubMed:22660413 46..50
LYPX(n)L motif 3. /evidence=ECO:0000305|PubMed:22660413 50..54
PDZ_signaling 113..192 CDD:238492 12/86 (14%)
PDZ_signaling 197..270 CDD:238492 10/36 (28%)
phosphatidylinositol-4, 5-bisphosphate-binding. /evidence=ECO:0000250|UniProtKB:O00560 251..252
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.