DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sv and DUXA

DIOPT Version :10

Sequence 1:NP_524633.3 Gene:sv / 43825 FlyBaseID:FBgn0005561 Length:844 Species:Drosophila melanogaster
Sequence 2:NP_001012747.1 Gene:DUXA / 503835 HGNCID:32179 Length:204 Species:Homo sapiens


Alignment Length:132 Identity:28/132 - (21%)
Similarity:44/132 - (33%) Gaps:37/132 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 HNLQNTRTGDSLSTTINTNQNQHGHQHLSGS-----NMYTSSQMEDKSKA---NKYDEYSSRTLS 127
            |..|.....::|.::.:..|:|.|.:..|..     ..|::||:....||   |.|....||  .
Human    70 HGFQKRPEAETLESSQSQGQDQPGVEFQSREARRCRTTYSASQLHTLIKAFMKNPYPGIDSR--E 132

  Fly   128 NISDANTTPSAN----------------------NFITQSQG--IEWITAMNDIQNG---AEDSH 165
            .::.....|.:.                      :...:.||  .|.:....|.|||   ..|||
Human   133 ELAKEIGVPESRVQIWFQNRRSRLLLQRKREPVASLEQEEQGKIPEGLQGAEDTQNGTNFTSDSH 197

  Fly   166 SS 167
            .|
Human   198 FS 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
svNP_524633.3 PAX 175..299 CDD:128645
DUXANP_001012747.1 homeodomain 16..74 CDD:238039 1/3 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 73..101 6/27 (22%)
Homeodomain 102..155 CDD:459649 10/54 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 163..204 11/37 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.