DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sv and Poxm

DIOPT Version :9

Sequence 1:NP_524633.3 Gene:sv / 43825 FlyBaseID:FBgn0005561 Length:844 Species:Drosophila melanogaster
Sequence 2:NP_001036687.1 Gene:Poxm / 40990 FlyBaseID:FBgn0003129 Length:370 Species:Drosophila melanogaster


Alignment Length:246 Identity:111/246 - (45%)
Similarity:144/246 - (58%) Gaps:53/246 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 HGGVNQLGGVFVNGRPLPDVVRQRIVELAHNGVRPCDISRQLRVSHGCVSKILSRYYETGSFKAG 240
            :|.|||||||||||||||:..|.||||||..|:||||||||||||||||||||:||:||||...|
  Fly    10 YGEVNQLGGVFVNGRPLPNATRMRIVELARLGIRPCDISRQLRVSHGCVSKILARYHETGSILPG 74

  Fly   241 VIGGSKPKVATPPVVDAIANYKRENPTMFAWEIRDRLLAEAICSQDNVPSVSSINRIVRNKAAEK 305
            .||||||:|.||.||:.|...|:.:|.:||||||||||:|.||.:.||||||||:||:|||....
  Fly    75 AIGGSKPRVTTPKVVNYIRELKQRDPGIFAWEIRDRLLSEGICDKTNVPSVSSISRILRNKLGSL 139

  Fly   306 AKHVHHHQQHHV---SQSLGGGHIATESVDSSTGTIGEPQPPTSNSSANSVN------------- 354
            .   |.|....|   ..|.|||.:::.. ..:.||          |::|::|             
  Fly   140 G---HQHTPGTVMGSGSSSGGGSVSSNG-GQNNGT----------SASNNINLSNLGNPGGGPHH 190

  Fly   355 -------TNVSASASVHASIPTSGTDSVQVSVGHINANSNETTHINSTAEQ 398
                   .:.:|:||.|                |::|:::...|:.::..|
  Fly   191 PHHHHHHQSAAAAASAH----------------HVHAHAHAHAHLYNSIYQ 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
svNP_524633.3 PAX 175..299 CDD:128645 88/122 (72%)
PoxmNP_001036687.1 PAX 10..133 CDD:128645 88/122 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450891
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45636
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.