DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sv and mix1

DIOPT Version :9

Sequence 1:NP_524633.3 Gene:sv / 43825 FlyBaseID:FBgn0005561 Length:844 Species:Drosophila melanogaster
Sequence 2:NP_988848.1 Gene:mix1 / 394439 XenbaseID:XB-GENE-485898 Length:357 Species:Xenopus tropicalis


Alignment Length:168 Identity:39/168 - (23%)
Similarity:59/168 - (35%) Gaps:25/168 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 HPHILHSTQEETLNTSTGQLEHDSQHLQQHHLTHHQQQDVSPTLHNLQNTRTGD-SLSTTINTNQ 90
            ||......|.:.:..|.....|.||....:   .....|||.....|.....|. .|..|.:...
 Frog   181 HPMATARAQAQPMKDSQANKFHQSQGFLPY---PDSSCDVSRQRFLLSQATPGTYHLPQTSSNIY 242

  Fly    91 NQHGHQHLSGSN---MYTSSQMEDKSKANKYDE-------YSSRTLSNISD---ANTTPSANNFI 142
            ||:|..|:...|   :|| ..||.....::..|       ||::|..||..   .:||.|.::.:
 Frog   243 NQNGKPHIPLWNQQPLYT-DMMEKVLDLSRRPEQMPVQPMYSTQTHKNIKSVVHGSTTLSHHSHM 306

  Fly   143 TQSQGIEWITAMNDIQNGAEDSHSSQGSISGDGHGGVN 180
            :       :.|..|..|.......:.|.:|.....||:
 Frog   307 S-------LFANQDPCNMPTTQGGTYGHVSPISDSGVS 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
svNP_524633.3 PAX 175..299 CDD:128645 2/6 (33%)
mix1NP_988848.1 Homeobox 90..143 CDD:278475
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.