DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sv and Gsc

DIOPT Version :9

Sequence 1:NP_524633.3 Gene:sv / 43825 FlyBaseID:FBgn0005561 Length:844 Species:Drosophila melanogaster
Sequence 2:NP_001137762.2 Gene:Gsc / 33240 FlyBaseID:FBgn0010323 Length:473 Species:Drosophila melanogaster


Alignment Length:296 Identity:55/296 - (18%)
Similarity:91/296 - (30%) Gaps:101/296 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   322 GGGHIATESVDSSTGTI------------------GEPQPPTSNSS-ANSVNTNVSASASVHASI 367
            |||...|.:..|:|..|                  ..|.||.:.|. |..|.||   |.....::
  Fly    10 GGGGGTTTTTPSTTPDIPPSKAKFKITVVSTPSPSPPPTPPPAGSMLAQMVETN---SPPAGYTL 71

  Fly   368 PTSGTD---------SVQVSVGHINANSNETTHINSTAEQRTTGYSINGILGIQHGHHSHNNNNN 423
            ..|.:|         .:..|.|:..|....|..:.::.:....|..:..:|..||..|..:.:..
  Fly    72 KRSPSDLGEQQQPPRQISRSPGNTAAYHLTTAMLLNSQQCGYLGQRLQSVLQQQHAQHQQSQSQT 136

  Fly   424 SSVNNNNNTESSCKRKRIEAHDENHDTNIHSDNDDGKRQRMSTYSGDQLYTNIWSGKWCIKDDHK 488
            .|                              :|||.:                ||...::::.:
  Fly   137 PS------------------------------SDDGSQ----------------SGVTILEEERR 155

  Fly   489 LLAELGNLTASTGNCPATYYEASNGFSTTPISGSGATASGNDTSMLYDSITTISQTQSSIYTPAI 553
                .|...||.....:.......|..|.|..||..:::||...:..:.|               
  Fly   156 ----GGAAAASLFTIDSILGSRQQGGGTAPSQGSHISSNGNQNGLTSNGI--------------- 201

  Fly   554 GPSIG---TGSLTPLVPISMHEMKLSANSIQEQTVP 586
              |:|   :|:.:|..|.|......:|:.|:.|.||
  Fly   202 --SLGLKRSGAESPASPNSNSSSSAAASPIRPQRVP 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
svNP_524633.3 PAX 175..299 CDD:128645
GscNP_001137762.2 Homeobox 343..396 CDD:278475
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451034
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.