DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sv and unc-4

DIOPT Version :9

Sequence 1:NP_524633.3 Gene:sv / 43825 FlyBaseID:FBgn0005561 Length:844 Species:Drosophila melanogaster
Sequence 2:NP_001285389.1 Gene:unc-4 / 32757 FlyBaseID:FBgn0024184 Length:588 Species:Drosophila melanogaster


Alignment Length:247 Identity:54/247 - (21%)
Similarity:86/247 - (34%) Gaps:77/247 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   638 ITETNSTRVKEPLTNSDGCS----------EDNNKEPEK------SNSSQSSDHIASPHLHHIGE 686
            :.||:....|:.|||::..|          .:||..|::      .:||.||:.|.:.|..:.|:
  Fly     2 VLETSEGDTKKFLTNNNNSSASRNNNSHNNNNNNHSPKEIPEETGRSSSTSSNSIPNAHRTNAGQ 66

  Fly   687 EQLRGNRRSNLNAST----------HPSSLIPLQPSGGSSLLNINPSENRSDVELNLSNNVGL-- 739
            ..|.|:..|..:.|.          ||::.:.|.    ::...:.|            |.|.:  
  Fly    67 HLLGGSPSSACSTSVSGCGMPSEGLHPTAALQLY----AAAAQLAP------------NGVRVPP 115

  Fly   740 ------YSTPTVL---------PSFNHYSAGCSSVVPGSDYAYNPAYTQYGGAYGSYGYGTGSGL 789
                  :..|.|.         |.|:..|||..   |.| .|...|.||......|..:...:||
  Fly   116 WGPFLQFGVPGVFGPNGPFLGRPRFDAASAGGH---PNS-AAAAAAATQMAAVNASNAFANLTGL 176

  Fly   790 INSSYYYES----------GQTQSPLTHDLRSPLVATRANSLASAASPGSGS 831
            ..::....|          ..|.:.:.|.|   ::..| .||..|..|..||
  Fly   177 SAAALRNVSAAQTTAVAAVASTVATIQHRL---MIGNR-QSLPPAGPPSEGS 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
svNP_524633.3 PAX 175..299 CDD:128645
unc-4NP_001285389.1 Homeobox 246..299 CDD:278475
NK <327..>368 CDD:302627
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450924
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.